SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|156938119|ref|YP_001435915.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156938119|ref|YP_001435915.1|
Domain Number 1 Region: 39-145
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 2.79e-16
Family TRAPP components 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156938119|ref|YP_001435915.1|
Sequence length 164
Comment hypothetical protein Igni_1332 [Ignicoccus hospitalis KIN4/I]
Sequence
MGSETYSLYVDESGSLRIKGDEADYLILPATTVSKIGSRLYKIVGEAANVQLAEIGRSIG
HSLAELIKRQMHGDRIEDIIESIDDYLSKSGFGKAELVKHENHFDVIINNPPSLRHAVEG
LKKCRFEAGLIKGILEEITGKKWHVQVDDSVNQEKCLIHVKPME
Download sequence
Identical sequences A8AC56
gi|156938119|ref|YP_001435915.1| 453591.Igni_1332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]