SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|156938131|ref|YP_001435927.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156938131|ref|YP_001435927.1|
Domain Number 1 Region: 7-136
Classification Level Classification E-value
Superfamily N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 3.53e-42
Family N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 0.00013
Further Details:      
 
Domain Number 2 Region: 138-269
Classification Level Classification E-value
Superfamily Translational machinery components 1.4e-36
Family ERF1/Dom34 middle domain-like 0.0015
Further Details:      
 
Domain Number 3 Region: 267-363
Classification Level Classification E-value
Superfamily L30e-like 2.95e-18
Family ERF1/Dom34 C-terminal domain-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|156938131|ref|YP_001435927.1|
Sequence length 363
Comment peptide chain release factor 1 [Ignicoccus hospitalis KIN4/I]
Sequence
MSQTKGVEISRAELKRLLKELEQWSAPATTLLSLYIPPGRPVGDVMELLRKELSVADNVK
LKKTREAVKAALTAAMERLKMFDKVPPNGLVIFCGVNPNTEKLECFTFSPPDKVPVFFYR
TDKKFHTEFLKDMVEEPEVYGLILVERGRMIVGALKGSRIEVLGEATGFIPGKHHRGGQS
QRRFDRLIEQAAEAFYKHAGERASQLLLPYLEQKRLKGVLIGGPAFSKQDFLEAGGLDYR
IKQLTIGLYDVADVDEHGLHELVQRAADDIKGQKYAEATKALEEFKRHLARDTGYAVYGE
AETLEALNMGMLKTLLISEDHPRLEEITELAKRYGTEVVVIEGVPEAEWFKKTFGIAGIK
RFK
Download sequence
Identical sequences A8AC68
453591.Igni_1344 gi|156938131|ref|YP_001435927.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]