SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|156938151|ref|YP_001435947.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156938151|ref|YP_001435947.1|
Domain Number 1 Region: 4-60
Classification Level Classification E-value
Superfamily Homeodomain-like 7.98e-17
Family Tetracyclin repressor-like, N-terminal domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|156938151|ref|YP_001435947.1|
Sequence length 181
Comment TetR family transcriptional regulator [Ignicoccus hospitalis KIN4/I]
Sequence
MSESPDTRAKILQAAREVFAEQGFQKGSIESIARRVGVSKTLVFWYFKNKENLVSEVIKT
VSPSRIVEECLKRKLKGHEMIDCLVDKYYDFLRNDINVKLTFHLLDLATLDPKYREMYET
FCEVDLKSIVKLITCNEGLGPLLDAFARALHGSLLCNVSSGTPKEYTKEVIKSLFSKYMK
C
Download sequence
Identical sequences A8AC88
453591.Igni_1364 gi|156938151|ref|YP_001435947.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]