SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|156938173|ref|YP_001435969.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|156938173|ref|YP_001435969.1|
Domain Number - Region: 120-164
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0125
Family FIS-like 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|156938173|ref|YP_001435969.1|
Sequence length 169
Comment hypothetical protein Igni_1386 [Ignicoccus hospitalis KIN4/I]
Sequence
MRLVWDYENGVVIDIETGEVVDYIVDFYVSEERFADKRVGSKISEEERALLKGTEIVKEL
NERGYRDVRGTFVQYKLGLTNKTVKSLEKVERLPEVPAELRTDFEYYLKLIERDPVLSAR
PKRSKHLMALVCAYVVNGKNVREVSKRYNVGEKTLRKLLALARERIIRT
Download sequence
Identical sequences A8ACB0
gi|156938173|ref|YP_001435969.1| 453591.Igni_1386 WP_012123526.1.33635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]