SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|558667332|ref|YP_008804042.1| from Pseudomonas aeruginosa PA1R

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|558667332|ref|YP_008804042.1|
Domain Number 1 Region: 2-172
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 2.75e-28
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|558667332|ref|YP_008804042.1|
Sequence length 176
Comment Cytochrome B561 [Pseudomonas aeruginosa PA1R]
Sequence
MSIRRYSPSQIALHWLSAVAVLLIIALPYGADFFAGLLGGKGNVFTLHKSLGVAVLLLTL
TRLALRRVQGVPDTLEGNPDWQRAAAKAGHFLLYAVLIVMPLSGMLAGKRPLDLFWLVQI
GPFDLPEAFKAFSGGTHVTVQYLLFALILGHAAAAIWHHRVQKDDVLRAMLPQRGA
Download sequence
Identical sequences WP_023517882.1.2927 WP_023517882.1.30994 WP_023517882.1.39458 WP_023517882.1.39704 WP_023517882.1.445 WP_023517882.1.51501 WP_023517882.1.81331 WP_023517882.1.89868 WP_023517882.1.95132 gi|558673683|ref|YP_008810391.1| gi|558667332|ref|YP_008804042.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]