SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|558667705|ref|YP_008804415.1| from Pseudomonas aeruginosa PA1R

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|558667705|ref|YP_008804415.1|
Domain Number 1 Region: 508-608
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.0000000000000072
Family Histidine kinase 0.024
Further Details:      
 
Domain Number 2 Region: 193-242
Classification Level Classification E-value
Superfamily HAMP domain-like 0.00000000106
Family HAMP domain 0.0047
Further Details:      
 
Weak hits

Sequence:  gi|558667705|ref|YP_008804415.1|
Domain Number - Region: 252-393
Classification Level Classification E-value
Superfamily GAF domain-like 0.000883
Family GAF domain 0.025
Further Details:      
 
Domain Number - Region: 88-132
Classification Level Classification E-value
Superfamily FlgN-like 0.0745
Family FlgN-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|558667705|ref|YP_008804415.1|
Sequence length 622
Comment Nitrate/nitrite sensor protein [Pseudomonas aeruginosa PA1R]
Sequence
MNKATAPDADQRDRFFGGSDRAGKPILRRSLVVRFGCYLTLLVSLALIGMFSALLFADYT
HQDAAVINHAGSLRMLTYRVALEPSLEGRQALLGTLGERLDSGDIRRLLQRQDADDPIRQ
LHQELREGLARLDPRALPGRAVLDAYVGDIDRFVGILQAKAERRSQLLSTVQGLCLFLSL
LVVFVTLYDLSYHVIGPLRELTSTARRLGRGELDARVTYSGEDELAQLGERFNQMAGELK
SIYGDLEERVEDKTRALSQSHQRLELLYASARRLGENPYDSRTLQPLLNQLEKVLDAGRV
TLCLNKDGVERAYSSLTTTERPADFCLQGDCGSCREQASACDQPSSLAQPLLMQPLSIAG
HRFGELFIESRSGRLENWQQQLIETFCDNIARTFALSLQQEQESRLALFAERGTIARELH
DSLAQSLSYLKIQVSRLGTLLKREAPAEKIEDTLDELREGLNGAYRQLRELLTTFRLSLD
EPSLEAALGNAVAEFGERGEVTIELDNRLQHVPLSPNEEIHVLQIVREALSNVVRHSQAQ
RAWVRLSSQADGQVSIAVEDDGVGFDPQQNRSGHYGLTIMQERGQTLGSQLRFEARAPHG
TRVLFSFVPTALQPSAAKEPTP
Download sequence
Identical sequences A0A0H3R0G2 A0A1E9CG26 A0A1F0IGH0 A0A1S1BSD6 G3XD66 O54040
gi|558674056|ref|YP_008810764.1| NYSGRC-FDAO-AAG07265 gi|218889842|ref|YP_002438706.1| 208964.PA3878 557722.PLES_11001 gi|392982397|ref|YP_006480984.1| gi|568307858|ref|YP_008980127.1| gi|568152241|ref|YP_008941189.1| gi|558667705|ref|YP_008804415.1| NP_252567.1.87394 WP_003105296.1.100179 WP_003105296.1.100276 WP_003105296.1.100456 WP_003105296.1.100523 WP_003105296.1.100654 WP_003105296.1.100723 WP_003105296.1.100777 WP_003105296.1.100786 WP_003105296.1.100809 WP_003105296.1.100810 WP_003105296.1.100872 WP_003105296.1.100983 WP_003105296.1.101021 WP_003105296.1.101090 WP_003105296.1.101340 WP_003105296.1.101572 WP_003105296.1.101642 WP_003105296.1.101712 WP_003105296.1.101739 WP_003105296.1.10179 WP_003105296.1.101809 WP_003105296.1.10185 WP_003105296.1.101871 WP_003105296.1.10201 WP_003105296.1.10204 WP_003105296.1.10257 WP_003105296.1.1037 WP_003105296.1.10407 WP_003105296.1.10419 WP_003105296.1.10435 WP_003105296.1.10457 WP_003105296.1.10468 WP_003105296.1.10477 WP_003105296.1.10482 WP_003105296.1.10513 WP_003105296.1.10529 WP_003105296.1.10572 WP_003105296.1.10636 WP_003105296.1.10641 WP_003105296.1.10684 WP_003105296.1.10856 WP_003105296.1.10901 WP_003105296.1.10949 WP_003105296.1.11026 WP_003105296.1.11058 WP_003105296.1.1107 WP_003105296.1.11163 WP_003105296.1.11178 WP_003105296.1.11381 WP_003105296.1.11388 WP_003105296.1.11410 WP_003105296.1.11417 WP_003105296.1.11454 WP_003105296.1.11568 WP_003105296.1.11569 WP_003105296.1.11653 WP_003105296.1.11744 WP_003105296.1.11754 WP_003105296.1.1180 WP_003105296.1.1187 WP_003105296.1.11943 WP_003105296.1.12018 WP_003105296.1.12120 WP_003105296.1.12208 WP_003105296.1.12240 WP_003105296.1.12302 WP_003105296.1.12354 WP_003105296.1.1238 WP_003105296.1.12530 WP_003105296.1.12561 WP_003105296.1.12657 WP_003105296.1.12670 WP_003105296.1.12687 WP_003105296.1.12838 WP_003105296.1.12891 WP_003105296.1.12934 WP_003105296.1.12980 WP_003105296.1.13232 WP_003105296.1.13242 WP_003105296.1.13315 WP_003105296.1.1333 WP_003105296.1.13407 WP_003105296.1.13529 WP_003105296.1.13622 WP_003105296.1.13785 WP_003105296.1.13795 WP_003105296.1.13865 WP_003105296.1.14049 WP_003105296.1.14078 WP_003105296.1.14096 WP_003105296.1.14204 WP_003105296.1.14424 WP_003105296.1.14460 WP_003105296.1.14463 WP_003105296.1.14640 WP_003105296.1.14714 WP_003105296.1.1475 WP_003105296.1.14754 WP_003105296.1.14820 WP_003105296.1.14835 WP_003105296.1.15130 WP_003105296.1.152 WP_003105296.1.15222 WP_003105296.1.15281 WP_003105296.1.15297 WP_003105296.1.15373 WP_003105296.1.15379 WP_003105296.1.15480 WP_003105296.1.15482 WP_003105296.1.16041 WP_003105296.1.16074 WP_003105296.1.16142 WP_003105296.1.16161 WP_003105296.1.16197 WP_003105296.1.162 WP_003105296.1.16239 WP_003105296.1.16242 WP_003105296.1.16267 WP_003105296.1.1646 WP_003105296.1.16660 WP_003105296.1.16694 WP_003105296.1.1670 WP_003105296.1.16782 WP_003105296.1.17022 WP_003105296.1.17162 WP_003105296.1.17353 WP_003105296.1.17370 WP_003105296.1.17397 WP_003105296.1.18052 WP_003105296.1.18117 WP_003105296.1.18204 WP_003105296.1.18234 WP_003105296.1.1824 WP_003105296.1.18349 WP_003105296.1.18493 WP_003105296.1.18547 WP_003105296.1.18653 WP_003105296.1.18728 WP_003105296.1.18769 WP_003105296.1.18852 WP_003105296.1.18911 WP_003105296.1.19260 WP_003105296.1.19269 WP_003105296.1.19376 WP_003105296.1.1938 WP_003105296.1.19591 WP_003105296.1.19703 WP_003105296.1.19931 WP_003105296.1.20024 WP_003105296.1.20070 WP_003105296.1.20125 WP_003105296.1.20216 WP_003105296.1.20764 WP_003105296.1.20854 WP_003105296.1.209 WP_003105296.1.20929 WP_003105296.1.21100 WP_003105296.1.21166 WP_003105296.1.21302 WP_003105296.1.21349 WP_003105296.1.2144 WP_003105296.1.21460 WP_003105296.1.21469 WP_003105296.1.21471 WP_003105296.1.21517 WP_003105296.1.21718 WP_003105296.1.21767 WP_003105296.1.21863 WP_003105296.1.2228 WP_003105296.1.22324 WP_003105296.1.22394 WP_003105296.1.22442 WP_003105296.1.22491 WP_003105296.1.22671 WP_003105296.1.22704 WP_003105296.1.22863 WP_003105296.1.2289 WP_003105296.1.22891 WP_003105296.1.23195 WP_003105296.1.2323 WP_003105296.1.23264 WP_003105296.1.23331 WP_003105296.1.23418 WP_003105296.1.23421 WP_003105296.1.23512 WP_003105296.1.23523 WP_003105296.1.23525 WP_003105296.1.23559 WP_003105296.1.23581 WP_003105296.1.236 WP_003105296.1.23611 WP_003105296.1.23715 WP_003105296.1.23739 WP_003105296.1.23769 WP_003105296.1.23782 WP_003105296.1.23794 WP_003105296.1.23884 WP_003105296.1.23925 WP_003105296.1.23983 WP_003105296.1.24066 WP_003105296.1.24101 WP_003105296.1.24351 WP_003105296.1.24447 WP_003105296.1.24662 WP_003105296.1.24851 WP_003105296.1.24862 WP_003105296.1.24869 WP_003105296.1.24879 WP_003105296.1.25033 WP_003105296.1.25052 WP_003105296.1.25067 WP_003105296.1.25075 WP_003105296.1.251 WP_003105296.1.2511 WP_003105296.1.25142 WP_003105296.1.25149 WP_003105296.1.25191 WP_003105296.1.25328 WP_003105296.1.25344 WP_003105296.1.25348 WP_003105296.1.2535 WP_003105296.1.25600 WP_003105296.1.25695 WP_003105296.1.25903 WP_003105296.1.2596 WP_003105296.1.26025 WP_003105296.1.26042 WP_003105296.1.26159 WP_003105296.1.26301 WP_003105296.1.26334 WP_003105296.1.26428 WP_003105296.1.26489 WP_003105296.1.2652 WP_003105296.1.26539 WP_003105296.1.26592 WP_003105296.1.26604 WP_003105296.1.26740 WP_003105296.1.26841 WP_003105296.1.26906 WP_003105296.1.26967 WP_003105296.1.27028 WP_003105296.1.27107 WP_003105296.1.27218 WP_003105296.1.27505 WP_003105296.1.27534 WP_003105296.1.27575 WP_003105296.1.27587 WP_003105296.1.27837 WP_003105296.1.27939 WP_003105296.1.27966 WP_003105296.1.28057 WP_003105296.1.28064 WP_003105296.1.28136 WP_003105296.1.28175 WP_003105296.1.28258 WP_003105296.1.283 WP_003105296.1.28316 WP_003105296.1.28329 WP_003105296.1.28372 WP_003105296.1.28382 WP_003105296.1.28528 WP_003105296.1.28560 WP_003105296.1.28602 WP_003105296.1.28623 WP_003105296.1.28800 WP_003105296.1.28823 WP_003105296.1.28838 WP_003105296.1.29062 WP_003105296.1.29096 WP_003105296.1.29158 WP_003105296.1.29179 WP_003105296.1.29208 WP_003105296.1.2927 WP_003105296.1.29401 WP_003105296.1.2941 WP_003105296.1.29438 WP_003105296.1.2948 WP_003105296.1.29481 WP_003105296.1.29498 WP_003105296.1.29501 WP_003105296.1.29577 WP_003105296.1.2961 WP_003105296.1.29668 WP_003105296.1.29753 WP_003105296.1.29767 WP_003105296.1.2980 WP_003105296.1.29848 WP_003105296.1.30000 WP_003105296.1.30254 WP_003105296.1.30365 WP_003105296.1.30474 WP_003105296.1.30475 WP_003105296.1.30614 WP_003105296.1.30740 WP_003105296.1.30797 WP_003105296.1.30815 WP_003105296.1.30973 WP_003105296.1.30994 WP_003105296.1.31045 WP_003105296.1.31076 WP_003105296.1.31147 WP_003105296.1.31279 WP_003105296.1.31361 WP_003105296.1.31501 WP_003105296.1.31565 WP_003105296.1.31741 WP_003105296.1.3179 WP_003105296.1.31848 WP_003105296.1.3189 WP_003105296.1.31939 WP_003105296.1.32134 WP_003105296.1.32137 WP_003105296.1.32289 WP_003105296.1.32314 WP_003105296.1.32447 WP_003105296.1.32523 WP_003105296.1.32544 WP_003105296.1.32596 WP_003105296.1.32641 WP_003105296.1.32711 WP_003105296.1.32879 WP_003105296.1.33186 WP_003105296.1.33204 WP_003105296.1.33210 WP_003105296.1.33216 WP_003105296.1.33387 WP_003105296.1.33455 WP_003105296.1.33521 WP_003105296.1.33523 WP_003105296.1.33549 WP_003105296.1.33733 WP_003105296.1.33734 WP_003105296.1.3376 WP_003105296.1.33774 WP_003105296.1.33801 WP_003105296.1.33822 WP_003105296.1.33824 WP_003105296.1.34039 WP_003105296.1.34136 WP_003105296.1.34151 WP_003105296.1.34306 WP_003105296.1.34317 WP_003105296.1.34324 WP_003105296.1.34401 WP_003105296.1.34402 WP_003105296.1.3452 WP_003105296.1.34568 WP_003105296.1.34625 WP_003105296.1.34689 WP_003105296.1.34784 WP_003105296.1.34821 WP_003105296.1.34832 WP_003105296.1.34836 WP_003105296.1.34876 WP_003105296.1.34901 WP_003105296.1.34922 WP_003105296.1.34942 WP_003105296.1.35036 WP_003105296.1.35104 WP_003105296.1.35231 WP_003105296.1.35281 WP_003105296.1.3531 WP_003105296.1.35325 WP_003105296.1.35353 WP_003105296.1.3540 WP_003105296.1.35480 WP_003105296.1.35512 WP_003105296.1.35573 WP_003105296.1.35639 WP_003105296.1.35641 WP_003105296.1.35669 WP_003105296.1.35679 WP_003105296.1.3568 WP_003105296.1.3576 WP_003105296.1.35768 WP_003105296.1.35822 WP_003105296.1.35857 WP_003105296.1.36266 WP_003105296.1.36378 WP_003105296.1.36435 WP_003105296.1.36487 WP_003105296.1.36521 WP_003105296.1.3662 WP_003105296.1.36630 WP_003105296.1.36665 WP_003105296.1.37125 WP_003105296.1.37163 WP_003105296.1.37208 WP_003105296.1.37319 WP_003105296.1.37366 WP_003105296.1.37512 WP_003105296.1.3781 WP_003105296.1.37826 WP_003105296.1.3792 WP_003105296.1.38003 WP_003105296.1.38087 WP_003105296.1.38102 WP_003105296.1.38151 WP_003105296.1.38186 WP_003105296.1.3821 WP_003105296.1.38319 WP_003105296.1.3833 WP_003105296.1.38337 WP_003105296.1.38406 WP_003105296.1.38430 WP_003105296.1.38502 WP_003105296.1.38505 WP_003105296.1.38657 WP_003105296.1.38706 WP_003105296.1.38727 WP_003105296.1.38834 WP_003105296.1.38971 WP_003105296.1.39046 WP_003105296.1.39088 WP_003105296.1.39122 WP_003105296.1.39326 WP_003105296.1.39345 WP_003105296.1.3943 WP_003105296.1.39444 WP_003105296.1.39452 WP_003105296.1.39458 WP_003105296.1.39704 WP_003105296.1.39949 WP_003105296.1.3998 WP_003105296.1.39989 WP_003105296.1.40059 WP_003105296.1.40135 WP_003105296.1.40207 WP_003105296.1.40213 WP_003105296.1.40419 WP_003105296.1.40512 WP_003105296.1.40513 WP_003105296.1.40541 WP_003105296.1.4058 WP_003105296.1.40595 WP_003105296.1.40703 WP_003105296.1.40994 WP_003105296.1.41291 WP_003105296.1.41301 WP_003105296.1.41492 WP_003105296.1.41502 WP_003105296.1.41618 WP_003105296.1.41624 WP_003105296.1.41625 WP_003105296.1.41748 WP_003105296.1.41773 WP_003105296.1.41846 WP_003105296.1.41871 WP_003105296.1.41888 WP_003105296.1.4190 WP_003105296.1.41939 WP_003105296.1.42019 WP_003105296.1.42041 WP_003105296.1.42146 WP_003105296.1.42259 WP_003105296.1.42423 WP_003105296.1.42463 WP_003105296.1.42643 WP_003105296.1.42696 WP_003105296.1.42754 WP_003105296.1.42778 WP_003105296.1.42789 WP_003105296.1.42856 WP_003105296.1.42917 WP_003105296.1.42972 WP_003105296.1.42973 WP_003105296.1.43024 WP_003105296.1.43049 WP_003105296.1.43107 WP_003105296.1.43293 WP_003105296.1.43330 WP_003105296.1.4348 WP_003105296.1.43603 WP_003105296.1.43662 WP_003105296.1.43667 WP_003105296.1.43673 WP_003105296.1.43783 WP_003105296.1.43811 WP_003105296.1.43826 WP_003105296.1.44046 WP_003105296.1.44213 WP_003105296.1.44373 WP_003105296.1.44434 WP_003105296.1.44563 WP_003105296.1.44739 WP_003105296.1.44760 WP_003105296.1.4493 WP_003105296.1.44959 WP_003105296.1.45063 WP_003105296.1.45090 WP_003105296.1.45146 WP_003105296.1.45202 WP_003105296.1.4522 WP_003105296.1.45306 WP_003105296.1.45312 WP_003105296.1.4532 WP_003105296.1.45328 WP_003105296.1.45464 WP_003105296.1.45478 WP_003105296.1.45485 WP_003105296.1.45711 WP_003105296.1.45723 WP_003105296.1.45818 WP_003105296.1.45920 WP_003105296.1.45934 WP_003105296.1.45961 WP_003105296.1.46032 WP_003105296.1.46093 WP_003105296.1.461 WP_003105296.1.46152 WP_003105296.1.46200 WP_003105296.1.46436 WP_003105296.1.46502 WP_003105296.1.46623 WP_003105296.1.46787 WP_003105296.1.46846 WP_003105296.1.46926 WP_003105296.1.47150 WP_003105296.1.47158 WP_003105296.1.47251 WP_003105296.1.4726 WP_003105296.1.47296 WP_003105296.1.47312 WP_003105296.1.47469 WP_003105296.1.47480 WP_003105296.1.47527 WP_003105296.1.47598 WP_003105296.1.47774 WP_003105296.1.47970 WP_003105296.1.48024 WP_003105296.1.48086 WP_003105296.1.48094 WP_003105296.1.48141 WP_003105296.1.48172 WP_003105296.1.48178 WP_003105296.1.48321 WP_003105296.1.4836 WP_003105296.1.48378 WP_003105296.1.48413 WP_003105296.1.48474 WP_003105296.1.48545 WP_003105296.1.48820 WP_003105296.1.48870 WP_003105296.1.49266 WP_003105296.1.49277 WP_003105296.1.49360 WP_003105296.1.49416 WP_003105296.1.49500 WP_003105296.1.49566 WP_003105296.1.49833 WP_003105296.1.49998 WP_003105296.1.50176 WP_003105296.1.50180 WP_003105296.1.50222 WP_003105296.1.5043 WP_003105296.1.50567 WP_003105296.1.50682 WP_003105296.1.50734 WP_003105296.1.50967 WP_003105296.1.50989 WP_003105296.1.51019 WP_003105296.1.51141 WP_003105296.1.5132 WP_003105296.1.51501 WP_003105296.1.51538 WP_003105296.1.51847 WP_003105296.1.51889 WP_003105296.1.51943 WP_003105296.1.51976 WP_003105296.1.52146 WP_003105296.1.52152 WP_003105296.1.5226 WP_003105296.1.52326 WP_003105296.1.52334 WP_003105296.1.5235 WP_003105296.1.52355 WP_003105296.1.5258 WP_003105296.1.5260 WP_003105296.1.52690 WP_003105296.1.52728 WP_003105296.1.52810 WP_003105296.1.53072 WP_003105296.1.53169 WP_003105296.1.53287 WP_003105296.1.53351 WP_003105296.1.53371 WP_003105296.1.53427 WP_003105296.1.53528 WP_003105296.1.53530 WP_003105296.1.53719 WP_003105296.1.53726 WP_003105296.1.53826 WP_003105296.1.53948 WP_003105296.1.54078 WP_003105296.1.54090 WP_003105296.1.54133 WP_003105296.1.54140 WP_003105296.1.54146 WP_003105296.1.5420 WP_003105296.1.54248 WP_003105296.1.54497 WP_003105296.1.54571 WP_003105296.1.54742 WP_003105296.1.54809 WP_003105296.1.54974 WP_003105296.1.55089 WP_003105296.1.55169 WP_003105296.1.55318 WP_003105296.1.55347 WP_003105296.1.55478 WP_003105296.1.55543 WP_003105296.1.56013 WP_003105296.1.56145 WP_003105296.1.56171 WP_003105296.1.56188 WP_003105296.1.56196 WP_003105296.1.56228 WP_003105296.1.56229 WP_003105296.1.56348 WP_003105296.1.56475 WP_003105296.1.56623 WP_003105296.1.56632 WP_003105296.1.56745 WP_003105296.1.56768 WP_003105296.1.56797 WP_003105296.1.56808 WP_003105296.1.56819 WP_003105296.1.57005 WP_003105296.1.57113 WP_003105296.1.57131 WP_003105296.1.57140 WP_003105296.1.5731 WP_003105296.1.57460 WP_003105296.1.57480 WP_003105296.1.57532 WP_003105296.1.57548 WP_003105296.1.57728 WP_003105296.1.57839 WP_003105296.1.58019 WP_003105296.1.58056 WP_003105296.1.58155 WP_003105296.1.58162 WP_003105296.1.58183 WP_003105296.1.58228 WP_003105296.1.58294 WP_003105296.1.58436 WP_003105296.1.58527 WP_003105296.1.58689 WP_003105296.1.5889 WP_003105296.1.59013 WP_003105296.1.59076 WP_003105296.1.59099 WP_003105296.1.59176 WP_003105296.1.59249 WP_003105296.1.59250 WP_003105296.1.5937 WP_003105296.1.594 WP_003105296.1.59469 WP_003105296.1.59563 WP_003105296.1.59688 WP_003105296.1.59724 WP_003105296.1.59759 WP_003105296.1.59797 WP_003105296.1.59831 WP_003105296.1.60051 WP_003105296.1.60082 WP_003105296.1.60085 WP_003105296.1.60206 WP_003105296.1.60261 WP_003105296.1.60347 WP_003105296.1.60415 WP_003105296.1.60467 WP_003105296.1.60509 WP_003105296.1.60600 WP_003105296.1.60603 WP_003105296.1.60686 WP_003105296.1.607 WP_003105296.1.60910 WP_003105296.1.61191 WP_003105296.1.61209 WP_003105296.1.61222 WP_003105296.1.61269 WP_003105296.1.61299 WP_003105296.1.61366 WP_003105296.1.61493 WP_003105296.1.61549 WP_003105296.1.61696 WP_003105296.1.6173 WP_003105296.1.61943 WP_003105296.1.62010 WP_003105296.1.62035 WP_003105296.1.62180 WP_003105296.1.62186 WP_003105296.1.62357 WP_003105296.1.62396 WP_003105296.1.62410 WP_003105296.1.6242 WP_003105296.1.62516 WP_003105296.1.62534 WP_003105296.1.62635 WP_003105296.1.62688 WP_003105296.1.62701 WP_003105296.1.62704 WP_003105296.1.62772 WP_003105296.1.6283 WP_003105296.1.62834 WP_003105296.1.62873 WP_003105296.1.62917 WP_003105296.1.63041 WP_003105296.1.63057 WP_003105296.1.63124 WP_003105296.1.63193 WP_003105296.1.63196 WP_003105296.1.63338 WP_003105296.1.63369 WP_003105296.1.63634 WP_003105296.1.63995 WP_003105296.1.64139 WP_003105296.1.64198 WP_003105296.1.64309 WP_003105296.1.64329 WP_003105296.1.64340 WP_003105296.1.64591 WP_003105296.1.64726 WP_003105296.1.64748 WP_003105296.1.64799 WP_003105296.1.64854 WP_003105296.1.64862 WP_003105296.1.64880 WP_003105296.1.64885 WP_003105296.1.64983 WP_003105296.1.65066 WP_003105296.1.65092 WP_003105296.1.65095 WP_003105296.1.65099 WP_003105296.1.65197 WP_003105296.1.65227 WP_003105296.1.65237 WP_003105296.1.65316 WP_003105296.1.65334 WP_003105296.1.65335 WP_003105296.1.65549 WP_003105296.1.65588 WP_003105296.1.65740 WP_003105296.1.65819 WP_003105296.1.6589 WP_003105296.1.66062 WP_003105296.1.66165 WP_003105296.1.66277 WP_003105296.1.66345 WP_003105296.1.66364 WP_003105296.1.66526 WP_003105296.1.66634 WP_003105296.1.66721 WP_003105296.1.66929 WP_003105296.1.66945 WP_003105296.1.67010 WP_003105296.1.67188 WP_003105296.1.67205 WP_003105296.1.67261 WP_003105296.1.6734 WP_003105296.1.67388 WP_003105296.1.67531 WP_003105296.1.67545 WP_003105296.1.67686 WP_003105296.1.67755 WP_003105296.1.67903 WP_003105296.1.67948 WP_003105296.1.68000 WP_003105296.1.6808 WP_003105296.1.68158 WP_003105296.1.68162 WP_003105296.1.68183 WP_003105296.1.68317 WP_003105296.1.68561 WP_003105296.1.68568 WP_003105296.1.68638 WP_003105296.1.68781 WP_003105296.1.68800 WP_003105296.1.68802 WP_003105296.1.68857 WP_003105296.1.68862 WP_003105296.1.68910 WP_003105296.1.68938 WP_003105296.1.6928 WP_003105296.1.6931 WP_003105296.1.6937 WP_003105296.1.69534 WP_003105296.1.69556 WP_003105296.1.69599 WP_003105296.1.69791 WP_003105296.1.69819 WP_003105296.1.70092 WP_003105296.1.70194 WP_003105296.1.70216 WP_003105296.1.70229 WP_003105296.1.70460 WP_003105296.1.70470 WP_003105296.1.70561 WP_003105296.1.70583 WP_003105296.1.70670 WP_003105296.1.70831 WP_003105296.1.70991 WP_003105296.1.71038 WP_003105296.1.71385 WP_003105296.1.71570 WP_003105296.1.71642 WP_003105296.1.71666 WP_003105296.1.71799 WP_003105296.1.72149 WP_003105296.1.72167 WP_003105296.1.72181 WP_003105296.1.72323 WP_003105296.1.72331 WP_003105296.1.72378 WP_003105296.1.72447 WP_003105296.1.72541 WP_003105296.1.72562 WP_003105296.1.72570 WP_003105296.1.72653 WP_003105296.1.72772 WP_003105296.1.73135 WP_003105296.1.73149 WP_003105296.1.7329 WP_003105296.1.733 WP_003105296.1.73455 WP_003105296.1.73523 WP_003105296.1.73651 WP_003105296.1.73728 WP_003105296.1.7382 WP_003105296.1.73860 WP_003105296.1.73889 WP_003105296.1.73911 WP_003105296.1.73941 WP_003105296.1.74 WP_003105296.1.74072 WP_003105296.1.74074 WP_003105296.1.74106 WP_003105296.1.74167 WP_003105296.1.74175 WP_003105296.1.74264 WP_003105296.1.74268 WP_003105296.1.7445 WP_003105296.1.74458 WP_003105296.1.74518 WP_003105296.1.74568 WP_003105296.1.74629 WP_003105296.1.74772 WP_003105296.1.74776 WP_003105296.1.748 WP_003105296.1.75204 WP_003105296.1.75277 WP_003105296.1.7547 WP_003105296.1.75599 WP_003105296.1.75631 WP_003105296.1.75771 WP_003105296.1.75825 WP_003105296.1.75826 WP_003105296.1.75860 WP_003105296.1.75935 WP_003105296.1.75947 WP_003105296.1.76145 WP_003105296.1.76192 WP_003105296.1.76355 WP_003105296.1.76399 WP_003105296.1.76441 WP_003105296.1.76484 WP_003105296.1.76543 WP_003105296.1.7666 WP_003105296.1.76716 WP_003105296.1.76922 WP_003105296.1.77235 WP_003105296.1.77286 WP_003105296.1.77490 WP_003105296.1.77566 WP_003105296.1.77686 WP_003105296.1.77750 WP_003105296.1.77769 WP_003105296.1.77819 WP_003105296.1.77834 WP_003105296.1.78112 WP_003105296.1.78158 WP_003105296.1.78280 WP_003105296.1.78380 WP_003105296.1.78409 WP_003105296.1.78430 WP_003105296.1.78437 WP_003105296.1.78623 WP_003105296.1.78669 WP_003105296.1.78693 WP_003105296.1.78810 WP_003105296.1.78954 WP_003105296.1.78986 WP_003105296.1.79007 WP_003105296.1.79053 WP_003105296.1.79193 WP_003105296.1.79279 WP_003105296.1.79357 WP_003105296.1.79364 WP_003105296.1.79431 WP_003105296.1.7945 WP_003105296.1.79463 WP_003105296.1.79507 WP_003105296.1.7953 WP_003105296.1.79544 WP_003105296.1.79601 WP_003105296.1.79631 WP_003105296.1.79788 WP_003105296.1.79862 WP_003105296.1.79986 WP_003105296.1.80033 WP_003105296.1.80174 WP_003105296.1.80306 WP_003105296.1.80410 WP_003105296.1.80481 WP_003105296.1.8051 WP_003105296.1.80627 WP_003105296.1.8064 WP_003105296.1.80644 WP_003105296.1.80846 WP_003105296.1.80892 WP_003105296.1.80929 WP_003105296.1.80931 WP_003105296.1.80938 WP_003105296.1.81082 WP_003105296.1.8110 WP_003105296.1.81206 WP_003105296.1.81331 WP_003105296.1.81487 WP_003105296.1.81581 WP_003105296.1.81591 WP_003105296.1.81622 WP_003105296.1.81643 WP_003105296.1.81728 WP_003105296.1.81742 WP_003105296.1.81748 WP_003105296.1.81771 WP_003105296.1.81784 WP_003105296.1.81834 WP_003105296.1.81950 WP_003105296.1.82117 WP_003105296.1.82127 WP_003105296.1.82178 WP_003105296.1.82260 WP_003105296.1.8227 WP_003105296.1.82310 WP_003105296.1.82442 WP_003105296.1.82487 WP_003105296.1.82580 WP_003105296.1.82604 WP_003105296.1.82606 WP_003105296.1.8284 WP_003105296.1.82882 WP_003105296.1.82887 WP_003105296.1.82936 WP_003105296.1.83025 WP_003105296.1.83131 WP_003105296.1.83184 WP_003105296.1.83394 WP_003105296.1.83463 WP_003105296.1.8353 WP_003105296.1.83534 WP_003105296.1.8357 WP_003105296.1.83637 WP_003105296.1.83715 WP_003105296.1.83946 WP_003105296.1.84003 WP_003105296.1.84008 WP_003105296.1.84162 WP_003105296.1.84174 WP_003105296.1.84177 WP_003105296.1.84190 WP_003105296.1.84203 WP_003105296.1.84297 WP_003105296.1.84374 WP_003105296.1.84404 WP_003105296.1.84439 WP_003105296.1.84471 WP_003105296.1.84538 WP_003105296.1.84589 WP_003105296.1.84715 WP_003105296.1.84754 WP_003105296.1.84792 WP_003105296.1.8484 WP_003105296.1.8498 WP_003105296.1.85018 WP_003105296.1.85028 WP_003105296.1.85220 WP_003105296.1.85290 WP_003105296.1.85298 WP_003105296.1.85303 WP_003105296.1.85318 WP_003105296.1.85357 WP_003105296.1.85446 WP_003105296.1.85574 WP_003105296.1.85633 WP_003105296.1.85897 WP_003105296.1.85910 WP_003105296.1.86055 WP_003105296.1.861 WP_003105296.1.86125 WP_003105296.1.86287 WP_003105296.1.86293 WP_003105296.1.86386 WP_003105296.1.86545 WP_003105296.1.86552 WP_003105296.1.86652 WP_003105296.1.86733 WP_003105296.1.86774 WP_003105296.1.86780 WP_003105296.1.86785 WP_003105296.1.86822 WP_003105296.1.86985 WP_003105296.1.87104 WP_003105296.1.87163 WP_003105296.1.8718 WP_003105296.1.87182 WP_003105296.1.87183 WP_003105296.1.87435 WP_003105296.1.8749 WP_003105296.1.87530 WP_003105296.1.87648 WP_003105296.1.88330 WP_003105296.1.88360 WP_003105296.1.88388 WP_003105296.1.8852 WP_003105296.1.88550 WP_003105296.1.88578 WP_003105296.1.88605 WP_003105296.1.88659 WP_003105296.1.88679 WP_003105296.1.88714 WP_003105296.1.88750 WP_003105296.1.88900 WP_003105296.1.88969 WP_003105296.1.89083 WP_003105296.1.89098 WP_003105296.1.8911 WP_003105296.1.89234 WP_003105296.1.89266 WP_003105296.1.89276 WP_003105296.1.89409 WP_003105296.1.89440 WP_003105296.1.89491 WP_003105296.1.89577 WP_003105296.1.89669 WP_003105296.1.8976 WP_003105296.1.89776 WP_003105296.1.89805 WP_003105296.1.89868 WP_003105296.1.90032 WP_003105296.1.90056 WP_003105296.1.90110 WP_003105296.1.90224 WP_003105296.1.90268 WP_003105296.1.9056 WP_003105296.1.90569 WP_003105296.1.90655 WP_003105296.1.90940 WP_003105296.1.90999 WP_003105296.1.91093 WP_003105296.1.91204 WP_003105296.1.91336 WP_003105296.1.91360 WP_003105296.1.91416 WP_003105296.1.9143 WP_003105296.1.91431 WP_003105296.1.91438 WP_003105296.1.91563 WP_003105296.1.91838 WP_003105296.1.91846 WP_003105296.1.9191 WP_003105296.1.92175 WP_003105296.1.92314 WP_003105296.1.92321 WP_003105296.1.92454 WP_003105296.1.92585 WP_003105296.1.92587 WP_003105296.1.92589 WP_003105296.1.92624 WP_003105296.1.92642 WP_003105296.1.92759 WP_003105296.1.92769 WP_003105296.1.92924 WP_003105296.1.93001 WP_003105296.1.93090 WP_003105296.1.93144 WP_003105296.1.93148 WP_003105296.1.93250 WP_003105296.1.93264 WP_003105296.1.93446 WP_003105296.1.9349 WP_003105296.1.93493 WP_003105296.1.93547 WP_003105296.1.93562 WP_003105296.1.93848 WP_003105296.1.94004 WP_003105296.1.94031 WP_003105296.1.94136 WP_003105296.1.94174 WP_003105296.1.94211 WP_003105296.1.94243 WP_003105296.1.94285 WP_003105296.1.94385 WP_003105296.1.94450 WP_003105296.1.94814 WP_003105296.1.94856 WP_003105296.1.94874 WP_003105296.1.94896 WP_003105296.1.94897 WP_003105296.1.95056 WP_003105296.1.95117 WP_003105296.1.95132 WP_003105296.1.95187 WP_003105296.1.95207 WP_003105296.1.95217 WP_003105296.1.95305 WP_003105296.1.95324 WP_003105296.1.95359 WP_003105296.1.95536 WP_003105296.1.95638 WP_003105296.1.95668 WP_003105296.1.95802 WP_003105296.1.95820 WP_003105296.1.95999 WP_003105296.1.96008 WP_003105296.1.9604 WP_003105296.1.96357 WP_003105296.1.96384 WP_003105296.1.96434 WP_003105296.1.96452 WP_003105296.1.96667 WP_003105296.1.96702 WP_003105296.1.96714 WP_003105296.1.96967 WP_003105296.1.97126 WP_003105296.1.97213 WP_003105296.1.9722 WP_003105296.1.97272 WP_003105296.1.977 WP_003105296.1.97826 WP_003105296.1.97877 WP_003105296.1.97968 WP_003105296.1.98276 WP_003105296.1.98433 WP_003105296.1.98515 WP_003105296.1.98573 WP_003105296.1.98600 WP_003105296.1.98610 WP_003105296.1.98678 WP_003105296.1.98693 WP_003105296.1.98788 WP_003105296.1.9885 WP_003105296.1.98926 WP_003105296.1.98958 WP_003105296.1.98960 WP_003105296.1.99068 WP_003105296.1.99214 WP_003105296.1.99386 WP_003105296.1.99389 WP_003105296.1.99461 WP_003105296.1.9951 WP_003105296.1.99516 WP_003105296.1.99654 WP_003105296.1.99662 WP_003105296.1.99746 WP_003105296.1.99757 WP_003105296.1.99795 WP_003105296.1.99835 WP_003105296.1.9989 gi|15599073|ref|NP_252567.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]