SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387789845|ref|YP_006254910.1| from Solitalea canadensis DSM 3403

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387789845|ref|YP_006254910.1|
Domain Number 1 Region: 23-258,322-354
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.09e-71
Family Type II chitinase 0.0000529
Further Details:      
 
Domain Number 2 Region: 258-321
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.0000000000000748
Family Chitinase insertion domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|387789845|ref|YP_006254910.1|
Sequence length 371
Comment chitinase [Solitalea canadensis DSM 3403]
Sequence
MISPKIKVLFSILALACFSLPVFAQQNNKFQVIAYFFGSPEQAEKVPAEKLTHIIFSFCH
LKGNKLNVDNAGDTATIKSLVGLKKQNPQLKVILSLGGWGGCETCSDVFSSAAARTEFAE
SVKQLNNYFGTDGIDLDWEYPAIEGLPGHKFGPQDKPNFTALVTELRRVLGKKQEISFAT
GGFQKCLEESIDWKNVMPQVNYVNLMSYDLVNGYSMVTGHHTGLYSVPQLKESADNGVSY
LLKQGVPAGKIIVGSAFYGRMFEGVENVNNGLFQSGKFKQGISYAQIREQMPNQTDFVYH
WDDLAKAPYLYSAEKKLFITYDDKRSIEYKTQYVIDKKLGGIMFWEIEEDAPTDGLLDVI
VNVKKNGSSLK
Download sequence
Identical sequences H8KP97
gi|387789845|ref|YP_006254910.1| WP_014678962.1.74489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]