SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387791152|ref|YP_006256217.1| from Solitalea canadensis DSM 3403

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387791152|ref|YP_006256217.1|
Domain Number 1 Region: 438-487
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0000000000000417
Family Rubredoxin 0.0031
Further Details:      
 
Weak hits

Sequence:  gi|387791152|ref|YP_006256217.1|
Domain Number - Region: 6-66
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 0.000283
Family Duplicated SiR/NiR-like domains 1 and 3 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|387791152|ref|YP_006256217.1|
Sequence length 489
Comment rubredoxin [Solitalea canadensis DSM 3403]
Sequence
MGKPRCIVKINLPGGILSAGDLRIIVKAAETVGVKEVQMGMRQQMYLTLPHGKVEMFTAI
LSESGMFHEIDFDEFPNIVSSYVADELFNHSNWLTEGVYADILDSFDFKPQLKLNIVDSS
QTFVPFFTGNINFISSNIPNYWYLYIRFPKVSVNYKWEGLIYTDDIPLLTKTIEDIILNN
KPLFYDKTTANGFLLQEKVEATNAFIYQNQTEELQFPDFSLPYYEGFNNYGKKVWLGIYR
RDEVFSISFLKDICAICLKTKIGRVYTTPWKSLIVKGIERDDQKYWSYILGKHQINVRHA
SNELNWQVEDLSTEGLSIKKYLARKFDSTDLKTHGLCFAIKTQPRTGLFGSVVIKKLHNY
RKDNAKSTDRFDILYTPNFNANSKNYIAYKKRIVLTELDTHLAELCRLYYEEKGLNDEFN
NELIDDSKQEETTALKMVYQCKSCLSIYDEAYGDELNNITVGVSFENLPPDYCCPICENG
KVNFVLTNI
Download sequence
Identical sequences H8KW20
WP_014680268.1.74489 gi|387791152|ref|YP_006256217.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]