SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387791434|ref|YP_006256499.1| from Solitalea canadensis DSM 3403

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387791434|ref|YP_006256499.1|
Domain Number 1 Region: 123-276
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 5.5e-42
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00057
Further Details:      
 
Domain Number 2 Region: 402-562
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.83e-29
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0014
Further Details:      
 
Domain Number 3 Region: 23-122
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.89e-24
Family Duplicated SiR/NiR-like domains 1 and 3 0.0088
Further Details:      
 
Domain Number 4 Region: 258-281,310-412
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.18e-17
Family Duplicated SiR/NiR-like domains 1 and 3 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|387791434|ref|YP_006256499.1|
Sequence length 699
Comment sulfite reductase subunit beta (hemoprotein) [Solitalea canadensis DSM 3403]
Sequence
MQSFRTELENPVVERDIIELERKIRLYRDGKIDEEKFRSLRLARGIYGQRQQGVQMVRIK
LPYGKVTTQQLERICQVSDEYSRGNLHITTRQDIQIHYVSLDRTPELWAELERDDITLRE
ACGNTVRNVTASATAGIDPKELFDVSPYAQAAFEYFLRNPVCQEMGRKVKIAFSSSESDT
AYTFMHDLGFIPKIRVVNGKEERGFKVMLAGGLGSQPYLAEVAFEFLPINQIIPFSEAVL
RVFDRYGERTKRHKARMKYLLQDVGLDGFLKLVEEERLALKYKVYEIDGTVTSELQPPAI
IELPDFELSDWQKYDKWLTTNVFQQKQTGYFSVGLKIANGDIKTPVARQLIQIINELTAD
EIRLTNTQGILLKYVPAVHLPYLFQKLNEIGLAEIGFESTADITSCPGTDTCNLGISNST
DITRELEKVIYDEYPEFIYGNDISIKISGCINSCGQHAMAAIGFHGSSMKKDKLVLPALQ
VLIGGGVLGDGAGAVADKVIKVPSKRGPDVLRLLLNDYQENRNEGEYFLSYYQRQGKIYF
YDLLNPLTDMDKITDDDFIDWGQTAPYVQAIGVGECAGVTIDLVATLLLESEEKTANAQE
AFEKAEYADSIYYAYTSFINTAKAILTSEGIKTNTQSGIIKDFDLNFVQSEKVKLPVSFE
ELVYQINKDEPTADFAAYYLDQARGFTQLIKTYREAALA
Download sequence
Identical sequences H8KUF8
gi|387791434|ref|YP_006256499.1| WP_014680550.1.74489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]