SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|156973727|ref|YP_001444634.1| from Vibrio harveyi ATCC BAA-1116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156973727|ref|YP_001444634.1|
Domain Number 1 Region: 107-321
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 6.03e-47
Family D-glucarate dehydratase-like 0.000000644
Further Details:      
 
Domain Number 2 Region: 1-100
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 9.03e-25
Family Enolase N-terminal domain-like 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|156973727|ref|YP_001444634.1|
Sequence length 329
Comment O-succinylbenzoate synthase [Vibrio campbellii ATCC BAA-1116]
Sequence
MRKAKIYRYCLPMDSGVILRDNKLTERKGYILELTEDDKVGRGEVAPLVGFSLEGTEEAG
IQLQAQAERWVANLPLDYNHMYPSVAFGLSMAHLELEGGLPAQGKYQVAPLCNGDPDDLI
PKLNEMEGEKVAKVKVGLYEPIRDGMLVNLFLESIPQLTLRLDANRAWTPEKAQQFAKYI
APSLRQRITFLEEPCRSPGDSLSFAINTGIAIAWDETLQDAVRREDFSLEDLTGVKTIII
KPTLIGSVDFCIKLIEKAKTLGIKAVVSSSIESSLGLNQLARLAQWQLPNEIPGLDTIGL
FKAQLEQGWPKCELPVLPLSEQELVWHSA
Download sequence
Identical sequences A7MV77
gi|538263076|gb|AGU94277.1| gi|156973727|ref|YP_001444634.1| WP_012127322.1.100291 WP_012127322.1.11576 338187.VIBHAR_01432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]