SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|159904410|ref|YP_001548072.1| from Methanococcus maripaludis C6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|159904410|ref|YP_001548072.1|
Domain Number 1 Region: 1-136
Classification Level Classification E-value
Superfamily Resolvase-like 4.45e-44
Family gamma,delta resolvase, catalytic domain 0.00011
Further Details:      
 
Domain Number 2 Region: 139-181
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000186
Family Cgl2762-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|159904410|ref|YP_001548072.1|
Sequence length 184
Comment resolvase domain-containing protein [Methanococcus maripaludis C6]
Sequence
MIIGYARVSTKDQNLERQLDELKKAGSEKIFLEKISGTKRNRPEFDKMFEVLRSGDVIVV
TELTRISRSTKDLVEIVETCKSLDVEIKSLKESWLDTTSAHGKLLFTIFAGLAEFERDLI
SERVKSGLNAARSRGRLGGRPKIDPEKVEMALKMYDSKEYTIKQILKATGISKFTLYNYL
EKRK
Download sequence
Identical sequences A9A7Y2
444158.MmarC6_0014 WP_012192829.1.31524 gi|159904410|ref|YP_001548072.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]