SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|159904846|ref|YP_001548508.1| from Methanococcus maripaludis C6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|159904846|ref|YP_001548508.1|
Domain Number 1 Region: 86-135
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000743
Family Psq domain 0.026
Further Details:      
 
Weak hits

Sequence:  gi|159904846|ref|YP_001548508.1|
Domain Number - Region: 16-67
Classification Level Classification E-value
Superfamily EspA/CesA-like 0.0497
Family EspA-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|159904846|ref|YP_001548508.1|
Sequence length 194
Comment hypothetical protein MmarC6_0458 [Methanococcus maripaludis C6]
Sequence
MSKILFLTLNSNLNRNLKMIQMSEKYKTYHTSKYLSKNEVEDLIKQGVDEVSMPKSVYEY
MEKKNKGALNRLLIFGVDVSITDQVGRPKKVEDNIKKKIIEEIINGKSIRKVAEEYDLKK
STIWDNIKDDMAKIKQEKFRKMIYDYKELLIEKGRYTDYIETLFLELDMNISNDNLKEAE
KILLKIIEYSKKKD
Download sequence
Identical sequences A9A6I0
WP_012193246.1.31524 444158.MmarC6_0458 gi|159904846|ref|YP_001548508.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]