SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|159905779|ref|YP_001549441.1| from Methanococcus maripaludis C6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|159905779|ref|YP_001549441.1|
Domain Number 1 Region: 4-104
Classification Level Classification E-value
Superfamily GlnB-like 1.72e-28
Family DUF190/COG1993 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|159905779|ref|YP_001549441.1|
Sequence length 109
Comment hypothetical protein MmarC6_1396 [Methanococcus maripaludis C6]
Sequence
MKKMSAKLLRIYLKEEDKHGKELLINSIIKTLKSNGIAGATVFKGYCGYGTRGFSRIDIL
RLSMNLPAVIECIDYEEKLNEVMPKLVEMVAENGLITMQDIEVFKELKK
Download sequence
Identical sequences A9AA36
WP_012194019.1.31524 444158.MmarC6_1396 gi|159905779|ref|YP_001549441.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]