SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|159905891|ref|YP_001549553.1| from Methanococcus maripaludis C6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|159905891|ref|YP_001549553.1|
Domain Number 1 Region: 2-103
Classification Level Classification E-value
Superfamily GlnB-like 4.08e-27
Family Divalent ion tolerance proteins CutA (CutA1) 0.0000803
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|159905891|ref|YP_001549553.1|
Sequence length 104
Comment CutA1 divalent ion tolerance protein [Methanococcus maripaludis C6]
Sequence
MGKPTLVYTTFPSLENAKSIVGYLLEKKMIACANLREHESHYLEDNDIVIKTEVGAFLKT
VENRWDILKDMINEIHPLETPVILKINIDDSNEEFENWICNITK
Download sequence
Identical sequences A9AAE8
444158.MmarC6_1508 WP_012194241.1.31524 gi|159905891|ref|YP_001549553.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]