SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|159905988|ref|YP_001549650.1| from Methanococcus maripaludis C6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|159905988|ref|YP_001549650.1|
Domain Number 1 Region: 5-77
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000457
Family CAP C-terminal domain-like 0.061
Further Details:      
 
Weak hits

Sequence:  gi|159905988|ref|YP_001549650.1|
Domain Number - Region: 92-123
Classification Level Classification E-value
Superfamily NfeD domain-like 0.051
Family NfeD domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|159905988|ref|YP_001549650.1|
Sequence length 269
Comment regulatory protein Crp [Methanococcus maripaludis C6]
Sequence
MKKRNITEFQILSEVVRKQPHIKQKEIADTLGITVQGVSEHMRNLIKDEQIRNKGRGEYV
ITEKGMASLKTWISDFKNYLNDVNQNLYRYKDVWPAIANEDVNPGETVGIYMKKGVIYVS
KNIESNATAKVFYGGTLGEDVAIHEIRGHIDVPTGNVIVLKIPSEVMGGSKNVDFDIIKN
TIEEYPDAVVATAGTVGTVIVNKLGIHPDIRFAVSEGIVSACNRGCDVIAIITGKMAEKI
IKTVDKNKLRYTLLNASKTTDSDEEPMFS
Download sequence
Identical sequences A9AAP5
gi|159905988|ref|YP_001549650.1| WP_012194334.1.31524 444158.MmarC6_1606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]