SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|159906006|ref|YP_001549668.1| from Methanococcus maripaludis C6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|159906006|ref|YP_001549668.1|
Domain Number 1 Region: 74-133
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000000000955
Family NfeD domain-like 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|159906006|ref|YP_001549668.1|
Sequence length 137
Comment hypothetical protein MmarC6_1624 [Methanococcus maripaludis C6]
Sequence
MELGYITIIIGMGLILLEAFLSGLNFPVAGVAVLIYGIFLLYAPEFALPSAIIAGLITAY
IMKRFVYKTGLNVKIGAENLIGEHGDLVDEIGENNYGHVIIHGERWQAKSETPIKKGSKV
VVTGIEGVSLLIEESSE
Download sequence
Identical sequences A9AAR3
WP_012194351.1.31524 gi|159906006|ref|YP_001549668.1| 444158.MmarC6_1624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]