SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|159906090|ref|YP_001549752.1| from Methanococcus maripaludis C6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|159906090|ref|YP_001549752.1|
Domain Number 1 Region: 1-213
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.84e-62
Family Phosphate binding protein-like 0.0000242
Further Details:      
 
Domain Number 2 Region: 216-287
Classification Level Classification E-value
Superfamily GlnB-like 7.45e-20
Family ATP phosphoribosyltransferase (ATP-PRTase, HisG), regulatory C-terminal domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|159906090|ref|YP_001549752.1|
Sequence length 288
Comment ATP phosphoribosyltransferase [Methanococcus maripaludis C6]
Sequence
MILLALPNKGRISKPVNEILEKSGLKISVHGRSLFAQTVDPEIKVMFARAKDIPEFVRDG
VADVGVTGYDLMLERDTEEELEMLLDFKFGNARLVIAAPENSSVNSIDDVKDGMKIATEF
PGLTKRYLEKKGLNLEIIELSGATEIAPFIGVSDLICDLTSTGTTLQLNRLKEVENVVSS
TTRLVANKKSMENPEKCVKINQVLSGIKSVLYAQSKRLIMMNAPKDKVSEITSIIPGMGG
PTVSEILSNDKMLAINAVIDENKVFETVTNLERLGARDILVVPIERIL
Download sequence
Identical sequences A9AAZ7
444158.MmarC6_1708 gi|159906090|ref|YP_001549752.1| WP_012194435.1.31524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]