SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|159906198|ref|YP_001549860.1| from Methanococcus maripaludis C6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|159906198|ref|YP_001549860.1|
Domain Number 1 Region: 2-66
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000185
Family Tetracyclin repressor-like, N-terminal domain 0.004
Further Details:      
 
Domain Number 2 Region: 92-193
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.00000000000307
Family Tetracyclin repressor-like, C-terminal domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|159906198|ref|YP_001549860.1|
Sequence length 195
Comment TetR family transcriptional regulator [Methanococcus maripaludis C6]
Sequence
MTRNLILEKSRELFLKKGYAETSLLEIAKECNISKRGLYYHFEKKEDLYIETINSILAEN
GKAVLACIEKETCFKNTIFEFIEQAIAIRNRYFSNYNNDVKKTVYFGPISDAIKNFPEIW
EFNNNIYENAIGKMVNRIILAQEMGEVKKELDPRSLAFHFCSIFEGLPLVSYYTNKKFDD
KARMVISSFWELIKN
Download sequence
Identical sequences A9ABA5
444158.MmarC6_1817 gi|159906198|ref|YP_001549860.1| WP_012194542.1.31524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]