SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|159906201|ref|YP_001549863.1| from Methanococcus maripaludis C6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|159906201|ref|YP_001549863.1|
Domain Number 1 Region: 67-199
Classification Level Classification E-value
Superfamily Ribonuclease H-like 6.96e-25
Family Ribonuclease H 0.0042
Further Details:      
 
Domain Number 2 Region: 3-47
Classification Level Classification E-value
Superfamily L9 N-domain-like 0.00000000000011
Family N-terminal domain of RNase HI 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|159906201|ref|YP_001549863.1|
Sequence length 201
Comment ribonuclease H [Methanococcus maripaludis C6]
Sequence
MSKIYAVRKGRKTGLFETWAECESQVKGFSGAEFKSFTSKKDAKDYLNQKTGQKQNSVKS
NEFKKDVMYAWVDGSFNLKNKEYGAGALVIFNGIEKEIKAKGNDEDLSKMRNVAGEILAS
ELAMDYAVSKNVKNLVIYHDYLGIEKWCTGEWKTNKAGTIEYKEKCKNYLKRLNIEFVKV
KAHSGDKNNEIADKLAKESLI
Download sequence
Identical sequences A9ABA8
gi|159906201|ref|YP_001549863.1| 444158.MmarC6_1820 WP_012194545.1.31524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]