SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|159905023|ref|YP_001548685.1| from Methanococcus maripaludis C6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|159905023|ref|YP_001548685.1|
Domain Number 1 Region: 2-192
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 4.71e-38
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|159905023|ref|YP_001548685.1|
Sequence length 202
Comment indolepyruvate oxidoreductase subunit B [Methanococcus maripaludis C6]
Sequence
MNFSVIICGVGGQGVVLASRLLAITAMNSGFHVNTAETLGMSQREGSVVSHLQFGENIRS
SLIPEGSADLIIGLEVSEVARNLHFLKKNGKIITNSKMILPSAKSSNEKYDSEKIINFIK
EKVKSTICIDFSEIAKVAGNPKSMNVSVLSAAFYTGFLPLKYDDFLKTIESEIPEKYQNI
NLNAAKLSAETISNILEGHDEQ
Download sequence
Identical sequences A9A7R1
WP_012193353.1.31524 444158.MmarC6_0636 gi|159905023|ref|YP_001548685.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]