SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158319558|ref|YP_001512065.1| from Alkaliphilus oremlandii OhILAs

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158319558|ref|YP_001512065.1|
Domain Number 1 Region: 84-178
Classification Level Classification E-value
Superfamily Ribosomal protein L6 3.36e-37
Family Ribosomal protein L6 0.0000294
Further Details:      
 
Domain Number 2 Region: 1-83
Classification Level Classification E-value
Superfamily Ribosomal protein L6 1.75e-24
Family Ribosomal protein L6 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158319558|ref|YP_001512065.1|
Sequence length 179
Comment 50S ribosomal protein L6 [Alkaliphilus oremlandii OhILAs]
Sequence
MSRIGLRPIEIPQGVEVKIDEKNFAVVKGPKGTLEQQLSKDMEIKIEENVINVVRPTDNK
KHKSLHGLTRTLLSNMVEGVTKGYEKKLELVGVGYRANKQGDKLVLTLGFSHPIEMVDPE
GITVEVPSQTEIFVKGINKQVVGNYAAKIRELRKPEPYKGKGVKYANEVIRRKVGKTGK
Download sequence
Identical sequences A8MLF5
WP_012158383.1.49300 gi|158319558|ref|YP_001512065.1| 350688.Clos_0507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]