SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158320537|ref|YP_001513044.1| from Alkaliphilus oremlandii OhILAs

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158320537|ref|YP_001513044.1|
Domain Number 1 Region: 166-355
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 4.97e-64
Family Methylesterase CheB, C-terminal domain 0.00000223
Further Details:      
 
Domain Number 2 Region: 5-125
Classification Level Classification E-value
Superfamily CheY-like 9.82e-30
Family CheY-related 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158320537|ref|YP_001513044.1|
Sequence length 358
Comment response regulator receiver modulated CheB methylesterase [Alkaliphilus oremlandii OhILAs]
Sequence
MGFNKKVRVLLVDDSAFMRKILTDIVNSTDTIEVIGVAKNGAEAINQVRSLNPDVVTMDI
EMPILNGIEALKRIMKDQPVPVIMLSSLTSDGADTTLTCLDIGAVDFIQKPSSVFRINID
ELKEELISKITTASRIDVKFKNKSIQKKDSKTSYSSNKLHFSKDRNKHNLIVIGTSTGGP
RALQSVIPLLPEDLPASILIVQHMPPGFTKSLADRLNTMSSITVKEAEDGEKILPGHAYI
APGSFHLKIKEKQSHDIFLQLTKEDPVSGHRPSVDALFESVSKHVHKNIIAVVMTGMGSD
GSRGVKKLKDNTECYVIAQDEASSIVYGMPRSAVNTGTVDDIVPLNEIANYILRKLGV
Download sequence
Identical sequences A8MHG1
WP_012159360.1.49300 350688.Clos_1505 gi|158320537|ref|YP_001513044.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]