SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|407695303|ref|YP_006820091.1| from Alcanivorax dieselolei B5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407695303|ref|YP_006820091.1|
Domain Number 1 Region: 3-363
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 3.1e-109
Family FMN-linked oxidoreductases 0.0000000106
Further Details:      
 
Domain Number 2 Region: 334-522
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 2.71e-45
Family N-terminal domain of adrenodoxin reductase-like 0.0000136
Further Details:      
 
Domain Number 3 Region: 470-628
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.35e-21
Family C-terminal domain of adrenodoxin reductase-like 0.0000554
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|407695303|ref|YP_006820091.1|
Sequence length 670
Comment 2,4-dienoyl-CoA reductase [Alcanivorax dieselolei B5]
Sequence
MSDYSRLLSPLDLGHTQLKNRVIMGSMHTGLEDRFWQFPKLAAYFAERARGGVGLIVTGG
FNPNRRGWFYPLAGTFNSRLDVRNHRLVTDAVHREGGKIVLQVLHAGRYSYHPFSGSASA
IKSPINPFKPKALSTREVRRTVQDFARTAALAKQAGYDGVEIMGSEGYLINQFTAPRTNK
RTDQYGGSAENRRRFPVEIVAETRRRCGDDFIVMYRLSAIDLVPDGCTREEVLALAREVE
GAGASLINTGIGWHEARVPTIVTSVPRAAFAEITKQIKDQVSIPVVASNRINDPDVAEDI
LANGWADAVSMARPMLADPEFVRKTEQGRVDEINTCIACNQACLDHTFELKRASCLVNPR
ACHETELVYLKTAKPKRVAVVGAGPAGLACATVAAERGHRVTLFDQADAIGGQFNMAKRI
PGKEEFYHTLRYFQRRLEVTGVELRLGQRVTTEELQQQGFDEIVVATGVVPRTPSIPGVD
HAKVVSYVDVLQGKVEVGEKVAIIGAGGIGFDVAEFLAEAPREGHQPLPEWLDEWGVDFT
SDARGGLVEPEPPKPQRHLYLLQRKDSSVGKGLNKTSGWVHRATLKQRQVEMLPGCDYQK
VDDQGLHLTVNGEARLLDVDHVVLCAGQEPLKELYREGEENLHLIGGAQLAAELDAKRAI
RQGAELAAAL
Download sequence
Identical sequences K0CAV7
gi|407695303|ref|YP_006820091.1| WP_014993824.1.85951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]