SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|407696842|ref|YP_006821630.1| from Alcanivorax dieselolei B5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407696842|ref|YP_006821630.1|
Domain Number 1 Region: 229-273,306-332,426-628
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 3.83e-43
Family CoA transferase alpha subunit-like 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|407696842|ref|YP_006821630.1|
Sequence length 721
Comment acetyl-CoA hydrolase/transferase family protein [Alcanivorax dieselolei B5]
Sequence
MPQHMDNAEQAVDRVLELTGGEVRLGLPLGLGKPNRFVNALYQRVKADRSLSLEIYTALS
LGRPGAGSDLERRFLEPFADRVFADYEELDYLHAVRKDALPENIRVFEFFFQPGSLLNST
DAQRHYISVNYTHAARDINARGVNVVAQLLATRERDGRRQYSFSCNPEVTLELLPMLKAR
RDAGETIVAVGQVHHDLPFMENDASLGRWLPEMDILLDDEQAQTRLFSTPNMPVSHQDHF
IGLHASTLVRDGGTLQIGIGALGDALVHHTLRRQHHNDEYRALLGQLPMSDSQRQLIERE
GGVGPFQQGLYGCSEMMTHGLLTLIDDGIIRRAVYDWPALQRRVLADAALTPTLALLDDM
RDSGDLPARLGADDLSRLRHYGIVQEALTLRDGGDNLSLPNGVVVPNDLEDGATREALKA
VLGRGLLGGTVMHGGFFLGPRAFYQRLRELDDDTRAAINMTRVNYINDLFGEEAICRLQR
RDARFINSAFSITLLGAAVADQLDDGRVLSGVGGQYNFVAQAHELAGARSILMVRAWRER
GGEAQSNVVFSYPHNTIPRHLRDIVVTEYGVADLRGRSDEEVVMATLNITDSRFQAQLLK
QAQEAGKLRRDYQIPEPHRHNTPEALQRLAARAGAGALPSFPLGSDFTNTEQRVLEALTW
LKAKVSQKEYLKLGRKALFQDYHAERYGEELARMGLADPDGLRERLYQRLLLTALEATKP
R
Download sequence
Identical sequences K0CHY9
gi|407696842|ref|YP_006821630.1| WP_014995353.1.85951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]