SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|407697863|ref|YP_006822651.1| from Alcanivorax dieselolei B5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407697863|ref|YP_006822651.1|
Domain Number 1 Region: 3-322
Classification Level Classification E-value
Superfamily FMN-binding split barrel 2.35e-128
Family UbiD middle domain-like 0.000000000232
Further Details:      
 
Domain Number 2 Region: 323-487
Classification Level Classification E-value
Superfamily UbiD C-terminal domain-like 1.2e-65
Family UbiD C-terminal domain-like 0.0000000638
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|407697863|ref|YP_006822651.1|
Sequence length 488
Comment 3-octaprenyl-4-hydroxybenzoate carboxy-lyase [Alcanivorax dieselolei B5]
Sequence
MKYRDLRDFIQQLEQQGELKRIQAAVDPRLEMTEICDRTLKAGGPALLFENPKGFSIPVL
GNLFGTERRVALGMGRDSIDELRELGELLAFLKEPEPPKGFRDAWSKLPIFRKVLSMGPK
LLSSAPCQEQVLEGGDVDLFQLPIQTCWPEDAGPLVTWPLVITRGPNKERQNLGIYRQQL
IGRNKLIMRWLSHRGGALDFQEWRQAHPGEPFPVAVALGADPATILGAVTPVPDTLSEYA
FAGLLRGGKTELIKAIGSDLQVPASAEFVLEGHIYPNEYADEGPFGDHTGYYNEVERFPV
FTVERITHRRDPIYHSTYTGRPPDEPAVLGLAMNEIFVPILKKQFPEIEDFYLPPEGCSY
RMAVVTMKKQYPGHAKRVMMGVWSFLRQFMYTKFVIVCDDDVNARDWKDVIWAITTRMDP
RRDTVLVDNTPIDYLDFASPVAGLGSKMGLDATSKWPGETDREWGRAITMSETVKMRVDE
IWDSLGID
Download sequence
Identical sequences K0CI88
WP_014996359.1.85951 gi|407697863|ref|YP_006822651.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]