SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226226002|ref|YP_002760108.1| from Gemmatimonas aurantiaca T-27

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226226002|ref|YP_002760108.1|
Domain Number 1 Region: 36-268
Classification Level Classification E-value
Superfamily Folate-binding domain 5.18e-50
Family Aminomethyltransferase folate-binding domain 0.0025
Further Details:      
 
Domain Number 2 Region: 281-332
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 0.00000343
Family Aminomethyltransferase beta-barrel domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|226226002|ref|YP_002760108.1|
Sequence length 357
Comment putative aminomethyl transferase [Gemmatimonas aurantiaca T-27]
Sequence
MSTTHDQPSPSATTDGVTEAPALPPVPLTAEEHHGYEALRQGVTWFAWPWRWTRIQGPKA
ADALNGLVTNDVTLLAVNASQYAAALTPKGKMVADMTIVRADEDTFLVGVDAGAVEGWLG
LARKYINPRLARTTDESALWNTWAIYGRNIATALQSLGIGENGAARIGDADIRVVPGPTL
AGMSGVWLIVPTDHAEHVRERIVAICGPESGAAVAELARIEGGRPSMFMDMDENTIPQEA
NLDTLDAISFTKGCYTGQETVARVHFRGHVNRHLRAVSSPVPLTRGTSLVDDAGKVVGEV
RSSAISPRLGPIAIALVRREIGPGTTIHARALPPKDTGASADAVLIPATVNTLPFPD
Download sequence
Identical sequences C1A5X8
379066.GAU_0596 gi|226226002|ref|YP_002760108.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]