SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|226226357|ref|YP_002760463.1| from Gemmatimonas aurantiaca T-27

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226226357|ref|YP_002760463.1|
Domain Number 1 Region: 4-135
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.14e-28
Family Transcriptional regulator Rrf2 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|226226357|ref|YP_002760463.1|
Sequence length 170
Comment Rrf2 family DNA binding protein [Gemmatimonas aurantiaca T-27]
Sequence
MKSDSRLSGVLHVLLHMAEHEGPSTSESLARAMDTNPVVVRRVMAGLRDRGFVRSEKGPG
GGWTIACDLRRVTLRDVYEALGEPRLLAIGNRSEAPQCLVEQAVNATLGDAFAEAEALLL
QRFGEVTLAALSADFHARFAKRGRSGSRNHSGRHKHTRPHAVTIEDTHDA
Download sequence
Identical sequences C1A6Y3
gi|226226357|ref|YP_002760463.1| 379066.GAU_0951 WP_012682440.1.17207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]