SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226227905|ref|YP_002762011.1| from Gemmatimonas aurantiaca T-27

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226227905|ref|YP_002762011.1|
Domain Number 1 Region: 13-289
Classification Level Classification E-value
Superfamily Folate-binding domain 1.16e-103
Family Aminomethyltransferase folate-binding domain 0.000000342
Further Details:      
 
Domain Number 2 Region: 281-371
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 1.96e-24
Family Aminomethyltransferase beta-barrel domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|226227905|ref|YP_002762011.1|
Sequence length 374
Comment aminomethyltransferase [Gemmatimonas aurantiaca T-27]
Sequence
MTANDTGAQGSALKRTPLHDVHVALGAKIVPFAGYEMPVQYPAGITVEHKAVRESCGMFD
VSHMGEVIVRGPDAIRFVSSVTSNDVAALGIGQVQYSTLLRADGTIVDDLLVYRFADHLM
LVINASNRDKDLAHLQAHLAGFDCTMEDISDATALLAVQGPQAPAIVAALADVPLDGVKY
YWFTEGRVAGVPCIISRTGYTGELGFELYFDATHATAVWNAVMAAGAVTPCGLGARDTLR
LEAGLCLYGNELDDQITPLEAGLNWLVKLGKAEPFLGKDVLVRQHQDGTDRKLVGFTFEE
RAIPRHGYPVVYGGVAFGEVRSGTMSPTLGIPVGTCYLPSAAAVEGTRFDVDIRGKRVPA
RVVKLPFYKRPGKA
Download sequence
Identical sequences C1ABD5
379066.GAU_2499 gi|226227905|ref|YP_002762011.1| WP_015894310.1.17207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]