SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226228259|ref|YP_002762365.1| from Gemmatimonas aurantiaca T-27

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226228259|ref|YP_002762365.1|
Domain Number 1 Region: 35-300
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 2.67e-74
Family Proline dehydrohenase domain of bifunctional PutA protein 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|226228259|ref|YP_002762365.1|
Sequence length 309
Comment putative proline dehydrogenase [Gemmatimonas aurantiaca T-27]
Sequence
MLRTGLLYLSRQQRIFNLIKNVGFARKMASRFVAGETIATALDAVTQLNAKGITASLDLL
GESVHNEAEARETGRQYLELLDRIAERKLDANVSVKLTALGQDISDELGVEVVREVLARA
KQYDSFVRLDMESSAYTDRTLDTFEQRLFPDFPDTVGVVLQSALRRTLDDVERANALPCR
VRICKGAYLEPPDVAFPDKADVDRNYVAAMHRLMEHGRYPGIATHDEKIIAEAKRFAKEK
GIAPDRFEFQMLYGVRRDLQEQVVREGYRMRVYVPFGSQWYPYLMRRLAERPANIAFMAG
NIVKESFRR
Download sequence
Identical sequences C1ABL8
WP_015894664.1.17207 gi|226228259|ref|YP_002762365.1| 379066.GAU_2853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]