SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226229337|ref|YP_002763443.1| from Gemmatimonas aurantiaca T-27

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226229337|ref|YP_002763443.1|
Domain Number 1 Region: 126-225,376-452
Classification Level Classification E-value
Superfamily TrmE connector domain 5.75e-38
Family TrmE connector domain 0.0012
Further Details:      
 
Domain Number 2 Region: 100-175,209-366
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.53e-36
Family G proteins 0.00036
Further Details:      
 
Domain Number 3 Region: 7-125
Classification Level Classification E-value
Superfamily Folate-binding domain 1.1e-31
Family TrmE formyl-THF-binding domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|226229337|ref|YP_002763443.1|
Sequence length 452
Comment putative tRNA modification GTPase TrmE [Gemmatimonas aurantiaca T-27]
Sequence
MIAGGDDTIVALATPPGRGAVALVRLSGARAVDIARALGAYDTGQPEARHALRAVLHDPV
SREPLDEVLVTWFAPPRSYTGEMTVEITTHGGHIAPMRVQAACIAAGARPALPGEFTRRA
VLNGRLDLLQAEAVADIIDARTSAMQQQALTQLDGGLSRRLLALREEVVHLEALIAYDID
FPEEDDGPIAASRITDAGERLVSSLDALLRTAPAGTMVRDGALVVLAGPPNAGKSSLFNA
LLGQSRAIVTPIAGTTRDAIEALLDRTPWPLRLVDTAGLRDTTDPIEQLGIEVSRRYLAQ
AQVVLACGDDMESVVQTIEALAPHTAASVLAVHTKWDLIGPETTWVNIHLVSAESGEGLT
SLLQAIDTALGATAVVSASNDAVITRERHRAGLTNARDEVRAFLDAWTSGALPAPVAAVH
LFTAREALSDLIGTIDTDDVLDRVFRDFCIGK
Download sequence
Identical sequences C1AEP6
gi|226229337|ref|YP_002763443.1| 379066.GAU_3931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]