SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226227433|ref|YP_002761539.1| from Gemmatimonas aurantiaca T-27

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226227433|ref|YP_002761539.1|
Domain Number 1 Region: 105-243
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.0000000000000017
Family GntR ligand-binding domain-like 0.023
Further Details:      
 
Domain Number 2 Region: 35-102
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000152
Family GntR-like transcriptional regulators 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|226227433|ref|YP_002761539.1|
Sequence length 256
Comment GntR family transcriptional regulator [Gemmatimonas aurantiaca T-27]
Sequence
MSSARTSRRATAGAINQPPTTVSANEGGGRGASVGRAYDEIRELIVHGRLAPGSRIIESD
IAERLGLSRTPVRSALHRLQQEGYVAMIDRMKETRLIVAPLTQADALELFQMVGHLEGLA
ARTAAERPQEERTEIVTRLRMLNGHLATAGLAVPSDPRRLFDHDTAFHRAYVEAGAGPRL
QALHDAIKPQAERYARLYVNSLVDEIGKSVEEHELINRAIEMGDAAGAQSAVENNWRNAA
VRLARVIDSQGERGSW
Download sequence
Identical sequences C1A992
gi|226227433|ref|YP_002761539.1| 379066.GAU_2027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]