SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|226228324|ref|YP_002762430.1| from Gemmatimonas aurantiaca T-27

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226228324|ref|YP_002762430.1|
Domain Number 1 Region: 73-152
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 9.42e-29
Family CO dehydrogenase ISP C-domain like 0.00071
Further Details:      
 
Domain Number 2 Region: 2-78
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.84e-25
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|226228324|ref|YP_002762430.1|
Sequence length 166
Comment oxidoreductase [Gemmatimonas aurantiaca T-27]
Sequence
MPISLKINGTSRTVDVPADMPLLWVLRDELDLKGTKFGCGANRCGACTVHVNGAAQRSCT
FPVSRAAGAEITTIEGLSPDGAHAVQKAWEELDVPQCGYCQAGQMMAAASLLEKTPKPTN
AQIDSALNTNLCRCATYLRIRAAVHRAAEIKAGGAAVGSSSAPGED
Download sequence
Identical sequences C1ABT3
WP_015894729.1.17207 gi|226228324|ref|YP_002762430.1| 379066.GAU_2918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]