SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256830377|ref|YP_003159105.1| from Desulfomicrobium baculatum DSM 4028

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256830377|ref|YP_003159105.1|
Domain Number 1 Region: 173-566
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 3.15e-86
Family beta-Lactamase/D-ala carboxypeptidase 0.00022
Further Details:      
 
Domain Number 2 Region: 59-222
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 2.88e-39
Family Penicillin binding protein dimerisation domain 0.0008
Further Details:      
 
Domain Number 3 Region: 586-639
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000000523
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256830377|ref|YP_003159105.1|
Sequence length 644
Comment peptidoglycan glycosyltransferase [Desulfomicrobium baculatum DSM 4028]
Sequence
MTKTGSKPSKDRSRGKILFAGVLFALALLGLWARAYFVQVVKGPEYAKMANRQYWASETV
SGKRGEIFDRNGLLLAKTIATPSVYVRPNEVKDVWAVSHRLGSILGMSPKSLAAMLGPKK
RFVWVARKISDAQAEAVKAEMLPGVYLETENSRQYPQGHMAGQLLGFVNMDGQGIEGLEK
SFNDLLVPSSTKYTVQKDAAGKRLSSLESGDRSSFNGQDLRLTLDSQVQLATEEALARSV
LRAKGKSGMALVVEVPTGEILAWGHYPFFNPNAVKKTRGEWKNRMAVDIFEPGSTMKPIM
VAAALQEKVCTPTKEYYCENGKWSVKGRRVKDTHKYENLTVSKIIRYSSNIGAAKIGLEL
GAAKFHRYLQELGFGRRIGLPLPGESAGLLNPVHQWKDVELANISFGQGLGVTMLQMADA
YLCIANGGVRQPLRLVHEAGRPVEGKRIFDSNVARMVMAMLEEVVQEDGTGTQARIEGVR
VAGKTGTAQKASPTGGYGGEYVASFVAIFPADKPRYLVCMMVDEPQAGHYGGVLVAPEVR
NIGVQLLNSSGMLAEPVETMQMAKVSPERFWAPVQRMENISVDQEFMPDLQGATVREALE
ILVARGIVPVVKGQGVIIDKQKPLPGEKWPADKKCQLWLTGQPG
Download sequence
Identical sequences C7LST9
gi|256830377|ref|YP_003159105.1| WP_015774778.1.63071 525897.Dbac_2612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]