SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256830436|ref|YP_003159164.1| from Desulfomicrobium baculatum DSM 4028

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256830436|ref|YP_003159164.1|
Domain Number 1 Region: 582-687
Classification Level Classification E-value
Superfamily SpoIIaa-like 3.34e-18
Family Anti-sigma factor antagonist SpoIIaa 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256830436|ref|YP_003159164.1|
Sequence length 736
Comment sulfate transporter [Desulfomicrobium baculatum DSM 4028]
Sequence
MGTLVLRMIPFFGWIKTYSTEHLKMDFMAGLTVALVLIPQSMAYAQLAGLPPYYGLYASF
LPPLIAALFGSSRQLSTGPVAVVSLMTAASLEPLATAGSASYIAYAVLLALAVGIFQLSL
GVLRLGLVVNFLSHPVVAGFTNAAAIIIATSQLSKMFGVSVDSAEHHYQTILRVAQAAME
YTHWPTLALGVFAFALMFVLKRFSPNVPNVLVAVALTTIFSWGTGFEHNAVTSVNSLAAP
KASQALADYNRAMQAQVDLATKRTALTTDMEEAKKSGELFALVDEEHELRRLSLEMEIAK
SQAQNLKAMLRSMLFQAVPEPDGRLKFYPQDSTVPVGAANDGRTWRLRIGNSLLDPLALT
MIGGGAVVGAVPSGLPALSVPHFDLGVMLRLLPSAMIIALLGFMEAISIAKAMAAKTGQS
LDPNQELIGQGLANILGAFSKSYPVSGSFSRSAVNLQAGAMTGFSSVFTSAVVLAALLFL
TPLLYHLPQCTLAAVIMMAVIGLIQPAGFLHSWKVAKYDGAISVITFIATLAFAPHLDKG
IMIGVILSLGVFLYRNMRPMVSSLARTEGGELRDATRFGLDLCAHVDMVRFNGPLFFANA
SFLDEAITGRLQSKKRLKHIVLVAKGINDMDASGEEALSLVIERCRSRGVDISLAGVNDT
VMAIMERSGLLDKIGRDHIYANMEKALCTVHFDAHCGSDEARCPLTTACQITARPQPQQP
RARAYAAAGSAQAERP
Download sequence
Identical sequences C7LSZ8
gi|256830436|ref|YP_003159164.1| 525897.Dbac_2671 WP_015774837.1.63071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]