SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|220911959|ref|YP_002487268.1| from Arthrobacter chlorophenolicus A6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220911959|ref|YP_002487268.1|
Domain Number 1 Region: 91-286
Classification Level Classification E-value
Superfamily Formyltransferase 1.83e-60
Family Formyltransferase 0.00023
Further Details:      
 
Domain Number 2 Region: 7-87
Classification Level Classification E-value
Superfamily ACT-like 1.04e-16
Family Glycine cleavage system transcriptional repressor 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|220911959|ref|YP_002487268.1|
Sequence length 286
Comment formyltetrahydrofolate deformylase [Arthrobacter chlorophenolicus A6]
Sequence
MNEDQLNQAYVLTLSCPDRPGIVHAVAGALLVAGSNIMDSQQYGSPATGNFFMRVEVTTA
APASELRAALEPVAAAFSMQWSLNTVGDKVRTLIMASTSAHCLNDLLFQQRSGTLPIEIP
AIVSNHRDLAGLAEFYGVPFHYIPVTKDTKEQAEDKLRALLAEHDIELTVLARYMQILSD
ELCTDLTGKAINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHFVTAALDEGPIIEQEVI
RVDHARTPEQFVQMGRDVEGRTLVQAVQWHAEHRVLLDGNRTVVFN
Download sequence
Identical sequences B8HER3
452863.Achl_1188 WP_015936402.1.59127 WP_015936402.1.81542 gi|220911959|ref|YP_002487268.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]