SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|220913084|ref|YP_002488393.1| from Arthrobacter chlorophenolicus A6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220913084|ref|YP_002488393.1|
Domain Number 1 Region: 3-294
Classification Level Classification E-value
Superfamily ATP synthase (F1-ATPase), gamma subunit 3.92e-79
Family ATP synthase (F1-ATPase), gamma subunit 0.0000366
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|220913084|ref|YP_002488393.1|
Sequence length 296
Comment F0F1 ATP synthase subunit gamma [Arthrobacter chlorophenolicus A6]
Sequence
MGAQIRVYRQKISSTTSMRKIFKAMELIATSRIGKARARVAASLPYANAITRAVSAVASQ
SEIDHPLTTEPEQIRRAAVLVITSDRGLAGSYSASVLKQAEGLNELLHAEGKEVKTYLVG
RKSQAYFDFRNREYARVWTGGTDAPEFGTAREIGAALLADFAADFEDGGVDEIHVVYTRF
KSMVTQEPTVIRLLPLEVVEEEAASESDLLPLYEFEPETEQVLDALLPRYIESRLFAAML
QAAASELAARQRAMKSAGDNATDLIKKYTRLRNTARQAEITQELSEIVAGADALAS
Download sequence
Identical sequences B8HAZ0
gi|220913084|ref|YP_002488393.1| 452863.Achl_2339 WP_015937517.1.59127 WP_015937517.1.81542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]