SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|220913710|ref|YP_002489019.1| from Arthrobacter chlorophenolicus A6

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|220913710|ref|YP_002489019.1|
Domain Number - Region: 5-125
Classification Level Classification E-value
Superfamily FlgN-like 0.000471
Family FlgN-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|220913710|ref|YP_002489019.1|
Sequence length 175
Comment hypothetical protein Achl_2969 [Arthrobacter chlorophenolicus A6]
Sequence
MGAEGLSASLWRERRQLELLLFRLETQLLYLNAGHTEWLSFTAADLESVLQNLRFETLAR
NVEAAGVAAEWGVPGEGTLPGLAAAAPEGIIGELLTKHLQEMASLLHRIESAREANAGAL
DSAIEGFARDADAAVNSPEPADELGYLAQQSTATHALQLVDECSQPLVKEFLGLD
Download sequence
Identical sequences B8HEI5
452863.Achl_2969 gi|220913710|ref|YP_002489019.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]