SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|220913733|ref|YP_002489042.1| from Arthrobacter chlorophenolicus A6

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|220913733|ref|YP_002489042.1|
Domain Number - Region: 37-100
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.00484
Family Phase 1 flagellin 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|220913733|ref|YP_002489042.1|
Sequence length 112
Comment flagellar hook-basal body complex subunit FliE [Arthrobacter chlorophenolicus A6]
Sequence
MPIDALGPISGLGALGRAVQPVQGTGYSDGAVSAAGAASGGGFATALTGALDNLQQLQST
SRELAVSAVTGNLDDIHAATLASSRAQITLELVAAVRNKGVDAFNEIMRMQA
Download sequence
Identical sequences B8HEK8
WP_015938149.1.59127 WP_015938149.1.81542 452863.Achl_2992 gi|220913733|ref|YP_002489042.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]