SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|220913739|ref|YP_002489048.1| from Arthrobacter chlorophenolicus A6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220913739|ref|YP_002489048.1|
Domain Number 1 Region: 1-391
Classification Level Classification E-value
Superfamily Phase 1 flagellin 2.35e-93
Family Phase 1 flagellin 0.00000646
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|220913739|ref|YP_002489048.1|
Sequence length 391
Comment flagellin domain-containing protein [Arthrobacter chlorophenolicus A6]
Sequence
MGMQINTNLAANNAYRSLSNTQNDLSKSLEKLSSGLRINRAGDDAAGLAISESLKSQIGG
LNVASRNAQDGIGLVQTAEGGLSQAHSILQRLRDLGVQAANDTNNTDSRAAIKTEATSLV
EELGRIAGSTDFNGTKLLNGDNASLKIQVGANGDAASQIGVDLSGANVKAIANTLNLGAL
ASGGSKFDIADATALAGAATFSSTKDGVVTTVTTADLGAAGSFTSVEGYADALRKDADFS
SKFTVSVEKDANGAGTGIVVQAKDGGDLLDADNATAGTGLAAGAATASVATGLDFSNASK
AQASITLIDTQIKNVSTARADLGATQNRLESAVQTINVAKENLTASNSRIRDTDMAEEMV
KFTRNNILSQAGTAMLAQANQSSQGVLQLLR
Download sequence
Identical sequences B8HEL4
gi|220913739|ref|YP_002489048.1| WP_015938155.1.59127 WP_015938155.1.81542 452863.Achl_2998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]