SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|220913740|ref|YP_002489049.1| from Arthrobacter chlorophenolicus A6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220913740|ref|YP_002489049.1|
Domain Number 1 Region: 2-131
Classification Level Classification E-value
Superfamily FlgN-like 0.000000615
Family FlgN-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|220913740|ref|YP_002489049.1|
Sequence length 160
Comment FlgN family protein [Arthrobacter chlorophenolicus A6]
Sequence
MAIHELSALLWRERELLDLLTFKLEEEQLLLTAGKSRWLPHGTKEVEQVLERLSKAGLAR
AVEVAAVAEQWGLPAESSLSELAAAAPDAAWAGILSTHLTAMQRQTAAIQELRDSNEQFL
RAAVRSTQETAADLRPSAATYDSQGRTGDASPSRLFDQKI
Download sequence
Identical sequences B8HEL5
452863.Achl_2999 WP_015938156.1.59127 WP_015938156.1.81542 gi|220913740|ref|YP_002489049.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]