SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|220913742|ref|YP_002489051.1| from Arthrobacter chlorophenolicus A6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220913742|ref|YP_002489051.1|
Domain Number 1 Region: 1-294
Classification Level Classification E-value
Superfamily Phase 1 flagellin 2.35e-57
Family Phase 1 flagellin 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|220913742|ref|YP_002489051.1|
Sequence length 294
Comment flagellar hook-associated protein 3 [Arthrobacter chlorophenolicus A6]
Sequence
MLNRVTNQTMAAAAQRNLQAGQAKLASLQEKGATLQNITRPSDDPAALAAALATRGQLQA
ADQYSNNISDGTGWLNTADSALGQATNVLNRIRDLMLQASNGSLNQPAKDAIAAEIEGLN
KDLLASANTKYLGRNVFAGNSDAAAAFTGQPPAFNGTPVSSVERRVDADRTVRVDADGGA
IFGDGAGSVFALVGDVVAAIRAGADPSGRLDAVDDRLKTVISGRAEVGTRQSLLEQARDA
VAAQKVTLESRRSAIEDADIGQVVLDLKLQETNYQVALAVTAKVLQPSLMDFLR
Download sequence
Identical sequences B8HEL7
WP_015938158.1.59127 WP_015938158.1.81542 452863.Achl_3001 gi|220913742|ref|YP_002489051.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]