SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|220914087|ref|YP_002489396.1| from Arthrobacter chlorophenolicus A6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220914087|ref|YP_002489396.1|
Domain Number 1 Region: 20-406
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 7.46e-101
Family Homocysteine S-methyltransferase 0.0000081
Further Details:      
 
Domain Number 2 Region: 916-1214
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 3.27e-87
Family Methionine synthase SAM-binding domain 0.00093
Further Details:      
 
Domain Number 3 Region: 364-630
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 3.01e-74
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.00019
Further Details:      
 
Domain Number 4 Region: 751-888
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 1.57e-36
Family Cobalamin (vitamin B12)-binding domain 0.00012
Further Details:      
 
Domain Number 5 Region: 668-750
Classification Level Classification E-value
Superfamily Methionine synthase domain 6.41e-25
Family Methionine synthase domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|220914087|ref|YP_002489396.1|
Sequence length 1214
Comment methionine synthase [Arthrobacter chlorophenolicus A6]
Sequence
MPRFALDIESVARPVRAQALLDAVNHRVVIADGAMGTMLQGRDLSLETDFQNLEGCNEIL
NDTRPDVIADIHDAYFATGIDAVETNTFGANWSNLSDYGIDDRIEELANKGARIARQRAE
AAEETDGRMRWVLGSMGPGTKLPSLGHTTYDHLKQTFALQAEGLIDGGADAFLIETSQDL
LQTKAAVNGCRQAIVSKGIRLPIFVEVTVETTGTMLMGSEIGAALTALEPLGVDAIGLNC
ATGPDEMSEHLRHLSKQSTVAIACMPNAGLPVLGPNGAHYPLSPAELATAHEQFVREFGL
GLVGGCCGTTPEHLAAVVERLAPFRAKAVETEDKTAPARIPTEREAGIASLYHHVNFDQE
SAYLAIGERTNANGSKAFRQAMLEERWDDCVDIAREQVRVGAHLLDVCIDYVGRDGVADI
KEIVSRFASASTLPLVIDSTEPPVLQAGLELIGGRPVVNSVNYEDGDGPTSRFARIMPLV
KEHGTAVIALTIDEQGQARTTDGKVAIASRLVDSLVNDWGMRVEDIIVDALTFPVATGQE
ETRRDGIETIEAIRQITTKYPGINTTLGVSNVSFGLNPAARMVLNSVFLHEAVQAGLTSG
IIDAAKIVPLASLPEEQRKVALDLVYDRREYDADGNVTYDPLAIMLDLFAGVDTAALKDQ
RAAELAALPTGERLQRRIIDGEGKGLEADLDLARSEGMSPLSIINDQLLEGMKVVGERFG
AGEMQLPFVLQSAEVMKNAVALLEPHMEKSDSSGKGTMVIATVRGDVHDIGKNLVDIILT
NNGYNVINIGIKQGIAEIIAAAEEHDADVIGMSGLLVKSTVVMKDNLAELQSRGLAKKWP
VILGGAALTRAYVEQDLAEQFEGTVRYAKDAFEGLALMEPLVRVARGEDPNSVGLPPLKK
RIHRSGPTFTVTEPEAMPGRSDVVADNAVPAPPFWGTRIVRGVALNDYASFLDERATFMG
QWGLKPGRGEDGASYEELVEREGRPRLRYWLDRILGEGMLDASVAYGYFPVVTEGEDVVV
LHHGEDRDGVLGAAGLLAPDGGSGGSIGTERLRFSFPRQRRDRHLCLADFVRSRESGQID
VLPVQLVTAGSKIEEFTSKMFAANQYRDYYELNGLVMQLTESLAEFWHSRIRKELGFAAE
EPKDKAGLFKLDYRGARFSLGYPACPDMEDRRKVVELLKPERMGVILSDELMLHPEQSTD
AFVFHHPEAKYFKV
Download sequence
Identical sequences B8HGP1
452863.Achl_3349 gi|220914087|ref|YP_002489396.1| WP_015938501.1.59127 WP_015938501.1.81542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]