SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220924409|ref|YP_002499711.1| from Methylobacterium nodulans ORS 2060

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220924409|ref|YP_002499711.1|
Domain Number 1 Region: 202-333
Classification Level Classification E-value
Superfamily OmpA-like 3.66e-27
Family OmpA-like 0.0013
Further Details:      
 
Domain Number 2 Region: 77-172
Classification Level Classification E-value
Superfamily PspA lactotransferrin-binding region 0.0000144
Family PspA lactotransferrin-binding region 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|220924409|ref|YP_002499711.1|
Sequence length 337
Comment OmpA/MotB domain-containing protein [Methylobacterium nodulans ORS 2060]
Sequence
MASRLLRRERALNVWPGYVDALTTLLLSVVFLLTIFVTGQFFLSQEISGRDSVLDRLNRQ
IAELTDLLALERSGRRTLEETTAALRSNLQESETERRRLQDALTADQGAQGKATELGRQL
DVEKGATNRALSQVELLSQQIAAMRQQLAALEEALAASETRDRESQARIADLGSRLNVAL
AQRVQELARYRSDFFGRLRQILGNRSDIRIVGDRFVLQSEVLFAAGQASLRAEAGPELDR
IATAIRELNRQIPSDIPWVLRVDGHTDARPISSSAFPSNWALSAARAIAVVQYLVGRGIP
PQHLLAGAFGEFQPIDTGTSDEAYARNRRIELKLTER
Download sequence
Identical sequences B8ID16
gi|220924409|ref|YP_002499711.1| 460265.Mnod_4541 WP_015931046.1.92880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]