SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269114826|ref|YP_003302589.1| from Mycoplasma hominis ATCC 23114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269114826|ref|YP_003302589.1|
Domain Number 1 Region: 4-216
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.68e-62
Family G proteins 0.000000136
Further Details:      
 
Domain Number 2 Region: 305-397
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 5.18e-33
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0000108
Further Details:      
 
Domain Number 3 Region: 208-304
Classification Level Classification E-value
Superfamily Translation proteins 7.07e-30
Family Elongation factors 0.0000127
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|269114826|ref|YP_003302589.1|
Sequence length 397
Comment Elongation factor Tu (EF-Tu) [Mycoplasma hominis ATCC 23114]
Sequence
MAKLDFDRSKPHVNIGTIGHVDHGKTTLTAAIATVLAKKGLAEARDYASIDNAPEEKARG
ITINTSHIEYQTEKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLARQVGVPKIVVFLNKIDMFKDDEREEMVGLVEMDVRSLLSEYGFDGDNAPIIAGSALK
ALQGDPEYEKGILELMDAVDTYIEEPKRETDKPFLMAVEDVFTITGRGTVATGRVERGVL
QLNEEVEIVGLKPTKKTVVTGIEMFRKNLKEAQAGDNAGLLLRGIDRSEVERGQVLAKPK
TIVPHTQFEATVYVLKKEEGGRHTPFFHNYKPQFYFRTTDVTGGIEFKPGREMVVPGDNV
ELTVTLIAPIAIEEGTKFSIREGGRTVGAGSVTKILK
Download sequence
Identical sequences A0A097NSI9 P22679
gi|269114826|ref|YP_003302589.1| 2098.MHO_0520 WP_012855329.1.12031 WP_012855329.1.17446 WP_012855329.1.24143 WP_012855329.1.24181 WP_012855329.1.35065 WP_012855329.1.71189 WP_012855329.1.72770 WP_012855329.1.80436 WP_012855329.1.80486 WP_012855329.1.87668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]