SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269114881|ref|YP_003302644.1| from Mycoplasma hominis ATCC 23114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269114881|ref|YP_003302644.1|
Domain Number 1 Region: 48-119
Classification Level Classification E-value
Superfamily Glucose permease domain IIB 0.00000000262
Family Glucose permease domain IIB 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269114881|ref|YP_003302644.1|
Sequence length 124
Comment hypothetical protein MHO_1070 [Mycoplasma hominis ATCC 23114]
Sequence
MLNKNKFLYIFLIIITLGLILIFWRKKYKVLKTKNYLTTDNEITFSMQDLILYLGGISNI
VSSSATQKIVRISFKNKANISIEKIKKLNGISGIAFQSSNISLVVGNCANYLSTLLNKEL
NNHE
Download sequence
Identical sequences D1J7P4
gi|269114881|ref|YP_003302644.1| WP_012855384.1.35065 WP_012855384.1.72559 WP_012855384.1.72770 WP_012855384.1.80486 WP_012855384.1.87668 2098.MHO_1070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]