SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269115040|ref|YP_003302803.1| from Mycoplasma hominis ATCC 23114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269115040|ref|YP_003302803.1|
Domain Number 1 Region: 1-97
Classification Level Classification E-value
Superfamily L21p-like 6.8e-32
Family Ribosomal protein L21p 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269115040|ref|YP_003302803.1|
Sequence length 100
Comment 50S ribosomal protein L21 [Mycoplasma hominis ATCC 23114]
Sequence
MFAIIETGGKQLLVKSGDVIYIEKIDGNEGDKVSFDKVLVIDEQVGSPYLPKASVLGTIE
KQGKAKKIVVYRHNAKSTHKRKLGHRQPFTRVKITEIKEK
Download sequence
Identical sequences A0A097NT66 D1J853
WP_012855541.1.12031 WP_012855541.1.17446 WP_012855541.1.24143 WP_012855541.1.24181 WP_012855541.1.35065 WP_012855541.1.71189 WP_012855541.1.72559 WP_012855541.1.72770 WP_012855541.1.75706 WP_012855541.1.80436 WP_012855541.1.80486 WP_012855541.1.87668 WP_012855541.1.92619 gi|269115040|ref|YP_003302803.1| 2098.MHO_2660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]