SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269115244|ref|YP_003303007.1| from Mycoplasma hominis ATCC 23114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269115244|ref|YP_003303007.1|
Domain Number 1 Region: 19-158
Classification Level Classification E-value
Superfamily RNase III domain-like 2.27e-32
Family RNase III catalytic domain-like 0.0019
Further Details:      
 
Domain Number 2 Region: 123-228
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.0000000000000377
Family Double-stranded RNA-binding domain (dsRBD) 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269115244|ref|YP_003303007.1|
Sequence length 231
Comment dsRNA-specific ribonuclease III [Mycoplasma hominis ATCC 23114]
Sequence
MKINFEENLQNALLKFGINFQKLDEQKRRYFCNAFTHSSYSNEHKNLESYQYLEFLGDSV
LGFVVSDFIFDNYKNFGEGKATKLKSEIVDKNALGFLSKYYGFPNCLRTGKSAFANGKGI
KSDSDLIESFIGACYKACGLKFTKEIIYHFIDKILKKFHNSINEHPKTKLQELVQSNWGC
RPRYEDQALNNGKFESKVFINNNLYGEGIGQSKKESQTKAASDALKKMAKI
Download sequence
Identical sequences D1J8Q7
WP_012855743.1.72770 gi|269115244|ref|YP_003303007.1| 2098.MHO_4690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]