SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|290579537|ref|YP_003483929.1| from Streptococcus mutans NN2025

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290579537|ref|YP_003483929.1|
Domain Number 1 Region: 8-212
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.37e-50
Family PP-loop ATPase 0.00034
Further Details:      
 
Domain Number 2 Region: 341-399
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.00000000105
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|290579537|ref|YP_003483929.1|
Sequence length 423
Comment cell-cycle protein [Streptococcus mutans NN2025]
Sequence
MTYEKVLKYVQEKKFFETHYNILIAVSGGVDSMNLLHFLHIYQKKLQIRIAVAHVNHKQR
PQADEEEIYLKNWARDNHIPFYTAVFKGIFSEKKARDFRYTFFKNIMKEHGYTALVTAHH
ANDQAETVFLRLLRGSRLRYLTGIKEIQEFGNGQLIRPFLKFHKKELPNIFHFDDDSNQG
NSYLRNRIRNHYLPILTQENPKLSQHLIQMSEETNLLFKAFSDLTSQLDIQDCQIFRSQS
EAIQYFLLQNYLRKFPNLEVSKAQFDNLLHILRTKDYYYDYLKNNYYLKKDKKRFKICKI
GPETDRFEGEKVLEYGSMVKYGQYIFSFQEGSDSKKGIAVKNDFPIIIRRRKPGDKIKLG
SHSKKLRRLFIDEKIPIFKRSNAIIVEQDSDIILILLDGVTYLRKGFKDDIMKGRLYIQN
RNW
Download sequence
Identical sequences gi|290579537|ref|YP_003483929.1| WP_002277946.1.27968 WP_002277946.1.28176 WP_002277946.1.29492 WP_002277946.1.30759 WP_002277946.1.32790 WP_002277946.1.43025 WP_002277946.1.51230 WP_002277946.1.5956 WP_002277946.1.5991 WP_002277946.1.60757 WP_002277946.1.62848 WP_002277946.1.66026 WP_002277946.1.67144 WP_002277946.1.69244 WP_002277946.1.80579 WP_002277946.1.81687 WP_002277946.1.83426 WP_002277946.1.89520 WP_002277946.1.91353 WP_002277946.1.91503 WP_002277946.1.94501 WP_002277946.1.96000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]