SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|290579624|ref|YP_003484016.1| from Streptococcus mutans NN2025

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290579624|ref|YP_003484016.1|
Domain Number 1 Region: 60-317
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5.14e-45
Family L-arabinose binding protein-like 0.00055
Further Details:      
 
Domain Number 2 Region: 4-61
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.000000000000322
Family GalR/LacI-like bacterial regulator 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|290579624|ref|YP_003484016.1|
Sequence length 332
Comment transcriptional regulator [Streptococcus mutans NN2025]
Sequence
MKRNPTINDVAQLANVSRGTVSNYINGITIREENKAKIEKAIAELKYVPNARARELKTSK
TSTVVLIVPTTWSPFFAELVYRMQVELDRIGFKMILANSHADPDEEEEILRMASLNQVTG
VITMSYSNIYNFINIGKKLNLVSIERFISEDVPLITSDNYGGGQLAAEKLITFGSKRFLL
LRRKTNHYNATDKRTEGFLHIMKENNLPVDIFEASLKENYIEEFIHYLKTHFSGDVLTFD
GIFGVTDEYAVIAKQVLFELNPSYLNKVNIIGFDGSKSQEKGSYQIASIRQPVEAMVKAA
VKVLKKLIDGEEVPSHYSKVFDVSFVEPERLV
Download sequence
Identical sequences A0A0E2EML0 Q8DWF4
NYSGXRC-11233k gi|290579624|ref|YP_003484016.1| NP_720581.1.8892 WP_002263583.1.101419 WP_002263583.1.11591 WP_002263583.1.15351 WP_002263583.1.15378 WP_002263583.1.15704 WP_002263583.1.15966 WP_002263583.1.1718 WP_002263583.1.17336 WP_002263583.1.17367 WP_002263583.1.17675 WP_002263583.1.18742 WP_002263583.1.18958 WP_002263583.1.2040 WP_002263583.1.2229 WP_002263583.1.23024 WP_002263583.1.24588 WP_002263583.1.2541 WP_002263583.1.26164 WP_002263583.1.27968 WP_002263583.1.28176 WP_002263583.1.28418 WP_002263583.1.29492 WP_002263583.1.30473 WP_002263583.1.30759 WP_002263583.1.34420 WP_002263583.1.34969 WP_002263583.1.3499 WP_002263583.1.3516 WP_002263583.1.36850 WP_002263583.1.37641 WP_002263583.1.38244 WP_002263583.1.4093 WP_002263583.1.41694 WP_002263583.1.41875 WP_002263583.1.43025 WP_002263583.1.44799 WP_002263583.1.45235 WP_002263583.1.45508 WP_002263583.1.49832 WP_002263583.1.50032 WP_002263583.1.50052 WP_002263583.1.50471 WP_002263583.1.50881 WP_002263583.1.51119 WP_002263583.1.51230 WP_002263583.1.51366 WP_002263583.1.51387 WP_002263583.1.51717 WP_002263583.1.51808 WP_002263583.1.53541 WP_002263583.1.55052 WP_002263583.1.56170 WP_002263583.1.57092 WP_002263583.1.5956 WP_002263583.1.5991 WP_002263583.1.60757 WP_002263583.1.60865 WP_002263583.1.62115 WP_002263583.1.62848 WP_002263583.1.64336 WP_002263583.1.65140 WP_002263583.1.65860 WP_002263583.1.66026 WP_002263583.1.67144 WP_002263583.1.67232 WP_002263583.1.68196 WP_002263583.1.6903 WP_002263583.1.69244 WP_002263583.1.69362 WP_002263583.1.70318 WP_002263583.1.70601 WP_002263583.1.71645 WP_002263583.1.71809 WP_002263583.1.72550 WP_002263583.1.72844 WP_002263583.1.73818 WP_002263583.1.74195 WP_002263583.1.7464 WP_002263583.1.75183 WP_002263583.1.75315 WP_002263583.1.77182 WP_002263583.1.77215 WP_002263583.1.78804 WP_002263583.1.80579 WP_002263583.1.80841 WP_002263583.1.80886 WP_002263583.1.81687 WP_002263583.1.82913 WP_002263583.1.83363 WP_002263583.1.83426 WP_002263583.1.83737 WP_002263583.1.8393 WP_002263583.1.86023 WP_002263583.1.8622 WP_002263583.1.86495 WP_002263583.1.87803 WP_002263583.1.88284 WP_002263583.1.89520 WP_002263583.1.90023 WP_002263583.1.90204 WP_002263583.1.90590 WP_002263583.1.9086 WP_002263583.1.91353 WP_002263583.1.91450 WP_002263583.1.91503 WP_002263583.1.91936 WP_002263583.1.93729 WP_002263583.1.94193 WP_002263583.1.94277 WP_002263583.1.94501 WP_002263583.1.94886 WP_002263583.1.95315 WP_002263583.1.95949 WP_002263583.1.96000 WP_002263583.1.98526 WP_002263583.1.98911 210007.SMU.105 gi|387785267|ref|YP_006250363.1| gi|24378626|ref|NP_720581.1| gi|397648894|ref|YP_006489421.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]