SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|290579717|ref|YP_003484109.1| from Streptococcus mutans NN2025

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290579717|ref|YP_003484109.1|
Domain Number 1 Region: 36-314
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 7.66e-58
Family L-arabinose binding protein-like 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|290579717|ref|YP_003484109.1|
Sequence length 320
Comment periplasmic sugar-binding protein [Streptococcus mutans NN2025]
Sequence
MKIQSLVKSLACLFVVLIISSLFFYYKEEPVFPRQTKIGATYMTMNNDFYKYLNAEVEKN
VNEQHDLLYTRDPALSIKKQVEQIRFFIKERVDVIIINPVDGNSKLLINSLKRARKQGIK
VIAVDSQFKDNSAINTTIVSDNYKAGVLCAQEMIRKQKGAKILLLEHRNALSATSRIQGF
LDTIKTHKDYQVVARIDSLGQTEIAMPKVKKLIENGLTFDTVMALNDRAAIGALAAVKGE
KLPTNPYIYGIDGSPDMKNLLSATSEVQATVAQSPYTMGQEVTKASIKLSKNQTYPKRIV
VPVELITKKTIGKYDLTGWQ
Download sequence
Identical sequences A0A0E2EQ75
WP_002274167.1.11591 WP_002274167.1.12313 WP_002274167.1.17336 WP_002274167.1.17675 WP_002274167.1.18958 WP_002274167.1.2040 WP_002274167.1.23024 WP_002274167.1.27968 WP_002274167.1.28176 WP_002274167.1.29492 WP_002274167.1.30473 WP_002274167.1.30759 WP_002274167.1.31808 WP_002274167.1.32790 WP_002274167.1.37641 WP_002274167.1.41875 WP_002274167.1.43025 WP_002274167.1.45508 WP_002274167.1.46710 WP_002274167.1.46900 WP_002274167.1.50052 WP_002274167.1.50471 WP_002274167.1.51230 WP_002274167.1.51366 WP_002274167.1.51387 WP_002274167.1.52951 WP_002274167.1.56945 WP_002274167.1.57092 WP_002274167.1.5956 WP_002274167.1.5991 WP_002274167.1.60757 WP_002274167.1.62848 WP_002274167.1.63887 WP_002274167.1.64300 WP_002274167.1.65140 WP_002274167.1.67144 WP_002274167.1.67232 WP_002274167.1.69244 WP_002274167.1.76683 WP_002274167.1.80579 WP_002274167.1.81687 WP_002274167.1.82630 WP_002274167.1.83426 WP_002274167.1.88284 WP_002274167.1.90023 WP_002274167.1.91353 WP_002274167.1.91450 WP_002274167.1.91503 WP_002274167.1.93729 WP_002274167.1.94501 WP_002274167.1.94637 WP_002274167.1.956 WP_002274167.1.95949 WP_002274167.1.96000 gi|290579717|ref|YP_003484109.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]